CAZyme Information: MGYG000002886_02410

Basic Information

• Species: Stenotrophomonas maltophilia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia
• CAZyme ID: MGYG000002886_02410
• CAZy Family: CE14
• CAZyme Description: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		27253.86	6.2527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002886	4276654	MAG	United States	North America

• Gene Location: Start: 7397; End: 8155 Strand: +

Full Sequence      

MGAVARTPLQGEGTQEQAWLHCDWLWQQPTTSATALCSGHDRMVVVAPHPDDEILGCGGL
LHHAAGQGINVSVVAVTDGEACYPGEPWWTPERLRSARRAELAAALGELGIPVGSIFHLG
IADGAVSAHEQGLEGWLQQYLQPRDLVLAPWRFDGHPDHEAAGRAACGAARAVGCHRLEY
PVWGWHWLDPACAHMAWEVPKLVDISAVASAKRNAIAHFRTQTGDVAGLNSPPVLPAHVL
ARFFRNYEVFLA

Enzyme Prediction     

No EC number prediction in MGYG000002886_02410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	45	129	4.1e-17	0.6532258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02585	PIG-L	2.77e-18	45	160	1	118	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.
COG2120	LmbE	8.89e-16	42	252	12	217	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
TIGR04001	thiol_BshB1	3.40e-10	47	222	8	178	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
PRK02122	PRK02122	8.95e-04	42	81	371	417	glucosamine-6-phosphate deaminase-like protein; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDE98039.1	2.47e-30	23	252	8	232
AWK88475.1	6.42e-26	44	252	45	273
ASP23227.1	4.66e-25	25	250	4	251
AUM75733.1	2.10e-22	39	250	15	230
ATC65701.1	1.23e-21	39	250	35	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAN_A	1.36e-16	43	247	4	204	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FQG1	7.26e-07	42	184	22	188	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) OX=196164 GN=mshB PE=3 SV=1
D5UVX0	3.05e-06	42	228	4	236	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / CCUG 35730 / CIP 100753 / JCM 10117 / KCTC 9821 / NBRC 16120 / NCIMB 702349 / NCTC 13040) OX=521096 GN=mshB PE=3 SV=1
A1SFT8	4.17e-06	42	241	6	228	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=mshB PE=3 SV=1
O31857	6.61e-06	41	248	3	218	Probable N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB2 PE=3 SV=2
C1AZH2	9.80e-06	42	222	5	241	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Rhodococcus opacus (strain B4) OX=632772 GN=mshB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002886_02410.