CAZyme Information: MGYG000002886_03038

Basic Information

• Species: Stenotrophomonas maltophilia
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia
• CAZyme ID: MGYG000002886_03038
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		43156	7.0714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002886	4276654	MAG	United States	North America

• Gene Location: Start: 6503; End: 7693 Strand: +

Full Sequence      

MFRQTVAVLAVLIAGALPIALHAAPAQPPIFGAYYPGGSAARYPVSSIPAERLTHLFYAF
STIEDGRCTVGAEAPKNFAALAELKKAHPHLRTLISIGGWGAGGFSDAALTEASRKRLVD
SCMALFFDRHAGSFDGVDIDWEFPVSGGPKELAHRPQDRANLTRLAQAFRVALDAHGRKE
RQPMLLTAALAAGRLQTDGPYDPAASYDLPALAKVFDFINLMSYDMGTGFSAVSTFNAPL
HEVPADPLAPELRRWNHVAGAVQYYREHGVPAEKLVLGVPFYGRGFKVTGDAADGLYQSY
SAPADAGDWRVIKARYLDQPGWTKHWQPQAQSPWLYNAGQKIFISYEDPRSIGLRAQFAR
EQGLAGVFMWELTGDDEQASLLNAMLGPWQKARIGD

Enzyme Prediction     

No EC number prediction in MGYG000002886_03038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	33	379	1.3e-74	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	6.77e-110	32	375	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	1.95e-103	32	375	3	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.61e-84	31	375	2	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.85e-83	33	376	10	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	6.10e-82	27	385	36	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG11349.1	5.01e-297	1	396	1	396
QJC73904.1	5.01e-297	1	396	1	396
QNG70314.1	5.01e-297	1	396	1	396
QGL72759.1	5.01e-297	1	396	1	396
QNG94988.1	2.04e-296	1	396	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KXN_A	4.63e-73	33	378	11	360	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	9.20e-73	37	378	17	360	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	5.12e-72	37	378	17	360	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	1.91e-67	77	375	109	406	ChainA, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	9.02e-59	77	375	144	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	3.71e-64	77	375	141	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q11174	3.81e-41	33	384	63	408	Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
P36362	6.43e-40	34	378	35	378	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q9D7Q1	9.04e-40	40	393	38	377	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
Q95M17	1.43e-39	54	383	52	373	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999060	0.000148	0.000187	0.000163	0.000146

TMHMM  Annotations     

start	end
7	26