CAZyme Information: MGYG000002889_01605

Basic Information

• Species: Pantoea sp002920175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea sp002920175
• CAZyme ID: MGYG000002889_01605
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000002889_10|CGC2	40473.63	9.4

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002889	4513078	MAG	United States	North America

• Gene Location: Start: 65023; End: 66099 Strand: +

Full Sequence      

MANPTHADVTPHNILLIKLRHHGDMLLTTPVINALRQRYPQANIDVLLYKETRPMLEAHP
AIRQLHVIDRKWKQEGSWRKLRHERDLLAAVRAAHYDIVINLADQWRSALITLVSRAPLR
IGFAFNKRNNAFWRLCHNRLVPTSNHNQLHTVEQNMSALTPLGISPQGARASMHYSAVDG
QKVDALLAEQRVDAAFIVFQPTSRWNFKCWEEEKVAATIDQLAQANRKVVLTAAPDKHEM
AMIARIQSLCTTPHLVSLAGQLTLPQLAALIDRARLFIGVDSAPMHMAAALDTPCIALFG
PTKLQFWRPWGENNRVIWAGDYGLLPNPDSIDTNTRERYLSAIPVDDVVEAARNFLHD

Enzyme Prediction     

No EC number prediction in MGYG000002889_01605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	85	324	5e-60	0.9066666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02201	heptsyl_trn_III	4.95e-157	14	356	2	343	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.55e-121	8	358	2	345	lipopolysaccharide core biosynthesis protein; Provisional
COG0859	RfaF	3.22e-79	11	356	1	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	3.79e-78	13	354	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	4.01e-49	78	327	1	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZX95784.1	7.78e-204	1	358	1	358
QCA02771.1	1.11e-203	1	358	1	358
QTC50644.1	9.06e-203	1	358	1	358
QIA53123.1	9.06e-203	1	358	1	358
AOE39521.1	9.06e-203	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	5.64e-20	14	356	11	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	3.66e-14	14	317	3	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	6.16e-13	14	319	3	299	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	6.16e-13	14	319	3	299	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	6.52e-13	14	319	3	299	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	2.77e-91	19	356	1	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	2.36e-85	19	356	1	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P37421	6.59e-16	14	317	3	305	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	4.05e-15	14	317	3	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P24173	2.38e-12	14	325	3	305	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002889_01605.