CAZyme Information: MGYG000002889_02320

Basic Information

• Species: Pantoea sp002920175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea sp002920175
• CAZyme ID: MGYG000002889_02320
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157	MGYG000002889_18|CGC1	17176.03	10.3158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002889	4513078	MAG	United States	North America

• Gene Location: Start: 54946; End: 55419 Strand: +

Full Sequence      

MWRPVIICLLLAAGGLAHAAKAPPEAARCFREAGIRFSVDWRLLQAIAEVESGLNPGAIG
LNKKGGRVLSEDLGMMQINSSWLPVLRPMGITREVLLGNACQNIHVGAWILAKNIAQNGV
NWTSVGAYNAGFKNANEPFRMRYARKVYARYIELTGN

Enzyme Prediction     

No EC number prediction in MGYG000002889_02320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	33	153	1.3e-23	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	1.55e-49	37	151	1	107	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	1.65e-39	27	156	19	144	type III secretion system invasion protein IagB.
pfam01464	SLT	5.27e-22	30	146	1	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	3.87e-17	26	151	19	142	lytic transglycosylase; Provisional
cd00254	LT-like	6.27e-13	42	151	2	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBJ48260.1	9.41e-110	1	157	1	157
QZY97764.1	8.98e-99	1	157	1	157
QIA54850.1	7.38e-98	1	157	1	157
AVF38279.1	5.05e-83	12	156	4	148
QTP13580.1	3.99e-78	1	156	1	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	5.35e-10	29	115	3	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X6H3	1.21e-27	29	154	28	156	Peptidoglycan-binding-like protein OS=Escherichia coli O157:H7 OX=83334 GN=pbl PE=3 SV=1
E1WAC2	1.13e-26	27	156	19	144	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.13e-26	27	156	19	144	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	9.02e-26	27	154	19	142	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	2.91e-25	27	156	18	143	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999129	0.000166	0.000157	0.000146	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002889_02320.