CAZyme Information: MGYG000002889_02322

Basic Information

• Species: Pantoea sp002920175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea sp002920175
• CAZyme ID: MGYG000002889_02322
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155	MGYG000002889_18|CGC1	17373.06	9.4655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002889	4513078	MAG	United States	North America

• Gene Location: Start: 55913; End: 56380 Strand: +

Full Sequence      

MSFKHLLYSLLLLTAFCMSTSAQAYCFQEAGARYHVSPQLLRAIAQVESGMNPHAIGYNR
NRQGNITSRDFGLMQINSTHLAKLKAMGVINDERDLLTQPCLNVQTGAWILAQHLQVCGL
TWQCLGSYNAGFADGNQARRMLYARKVYSIWLASR

Enzyme Prediction     

No EC number prediction in MGYG000002889_02322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	27	149	5.3e-21	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	2.24e-50	34	151	1	107	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	4.65e-43	19	148	14	136	type III secretion system invasion protein IagB.
pfam01464	SLT	3.36e-27	27	146	1	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	7.50e-23	26	151	22	142	lytic transglycosylase; Provisional
COG0741	MltE	1.04e-16	27	154	143	263	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY97801.1	3.38e-93	10	155	10	155
CBJ48261.1	7.31e-93	11	155	11	157
QIA54848.1	1.00e-92	1	155	1	156
AVF38208.1	1.34e-81	19	155	20	156
QIE99867.1	3.84e-81	22	155	23	156

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X6H3	2.98e-46	22	151	24	153	Peptidoglycan-binding-like protein OS=Escherichia coli O157:H7 OX=83334 GN=pbl PE=3 SV=1
Q46790	3.70e-40	26	146	28	148	Putative peptidoglycan-binding-like protein OS=Escherichia coli (strain K12) OX=83333 GN=pbl PE=5 SV=2
P43018	1.50e-26	21	148	16	136	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	2.12e-26	21	148	16	136	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.12e-26	21	148	16	136	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000361	0.996457	0.002521	0.000222	0.000216	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002889_02322.