CAZyme Information: MGYG000002891_01389

Basic Information

• Species: Streptococcus sp900546335
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900546335
• CAZyme ID: MGYG000002891_01389
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002891_86|CGC1	42552.88	5.1116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002891	1652745	MAG	United States	North America

• Gene Location: Start: 2685; End: 3788 Strand: -

Full Sequence      

MKTNKLKYVWFVLILSIFCLALFLARGRTKIEMRNRIYSQWSQQFLVTKGNQSYVRTTSD
SEGTTVLSEAQSYGMLITVLASQKGQASQADYESLYRYYQNHRIEGTQLMSWKQVIKNDS
ETVEKQNATDGDLYIAYSLIEAAKQWPDKAQEYQEQAKKILDDILKYNYNEETGVLTVGN
WANKDSDYYYLMRTSDTLPHYFQSFYDLTGNKQWLDVKDKMLGQLEQISSHSDTGLLPDF
IWAEKSGARLVDANTIESQYDGAYSYNACRLPYHLSQSQDERSQKLVQKMMDFFMKEQRI
YAGYDLNGTALNQYQAGSFLAPITYASDKGEGYLKLLQQNKYIFTQDLPSDNYYDATMIT
MIALEMF

Enzyme Prediction     

No EC number prediction in MGYG000002891_01389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	363	1.9e-69	0.978125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	3.27e-24	38	364	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.21e-20	37	296	25	277	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.16e-07	64	173	52	153	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL97167.1	1.53e-265	1	367	1	367
QCZ57367.1	9.87e-262	1	367	1	367
AQA08566.1	1.15e-260	1	367	1	367
CBZ00311.1	1.15e-260	1	367	1	367
AHZ47396.1	6.66e-260	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.69e-38	29	322	54	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.63e-27	38	327	35	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.87e-27	38	327	41	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	9.16e-12	68	276	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	1.10e-07	68	274	48	244	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.29e-37	38	322	66	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	5.75e-24	68	326	129	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37696	2.60e-08	68	274	56	252	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	1.20e-06	68	266	54	248	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	2.12e-06	68	266	54	248	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.854961	0.093012	0.048139	0.000432	0.000280	0.003199

TMHMM  Annotations     

start	end
7	25