CAZyme Information: MGYG000002894_00882

Basic Information

• Species: Winkia sp002849225
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Winkia; Winkia sp002849225
• CAZyme ID: MGYG000002894_00882
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000002894_15|CGC1	70504.28	8.9921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002894	2092236	MAG	United States	North America

• Gene Location: Start: 35949; End: 37838 Strand: -

Full Sequence      

MALSEFRKELWHLRHGGIAQLKEHRLRQRAINIKPAPKSAPSDKSAGGKAVSFGSWPIPT
PEAARHQVTAAVILDEFSDLALRFEWNQIPVSPGGFREQLEGKKIDLLFVESAWHGNSDK
WRFMVVGPKTPTSRLKELVSYCKERSIPTVFWNKEDPAHYHEAIATARLFDYVFTTDQTL
LEQYRADLGHERVGVLPFAAQPSVHNPIRLSSGGKVPPRRDVAFAGMYFAHKFPERRAQM
GMLLGAADEVSPRMSKGLDIFSRYLGGDPRYQFPTPLDKRVVGSLAYPQMLTAYRGYKAF
LNVNSVVTSPSMCARRIFEISACGTPIVSAPSPAIDNFFTPDEVVQVGNSQEAGYALRAL
VGNEELRSRMTHLAQRRIWQEHTYAHRVNQVLQTIGLEGAQWHLPTVTPMISTNRPEQVA
HVLYYLHAQVGVEMAPVILAHGFTPSRTEVARAKELGLDVTWLYAPATESLGQCYNRILQ
VAQGDWVAKMDDDDLYSPYYLLEQLAATDYSGADLVGKHAHYMYLASKDVTVLRFTPWEH
RFTSFVSGPTIVGRRDLLQEVGFVDRTTGEDSALLKDVSASGGKIFSTSRFGFVQMRGSQ
KHTWAVSDFEVLANSRLSHYGRPNKTELP

Enzyme Prediction     

No EC number prediction in MGYG000002894_00882.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13524	Glyco_trans_1_2	6.02e-21	300	393	2	93	Glycosyl transferases group 1.
COG4641	COG4641	1.39e-20	137	395	97	359	Spore maturation protein CgeB [Cell cycle control, cell division, chromosome partitioning].
pfam12996	DUF3880	5.70e-13	152	228	1	77	DUF based on E. rectale Gene description (DUF3880). Based on Eubacterium rectale gene EUBREC_3218. As seen in gene expression experiments (http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE14737), It appears to be upregulated in the presence of Bacteroides thetaiotaomicron vs when isolated in culture.
cd03801	GT4_PimA-like	1.18e-07	162	395	133	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03794	GT4_WbuB-like	6.99e-06	168	392	162	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATG50901.1	2.45e-219	3	622	10	634
ACU86543.1	4.93e-219	3	622	10	634
VEH75118.1	8.28e-217	3	621	7	630
BAG29604.1	8.28e-217	3	621	7	630
ASE10509.2	2.45e-215	10	621	1	617

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002894_00882.