CAZyme Information: MGYG000002894_01259

Basic Information

• Species: Winkia sp002849225
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Winkia; Winkia sp002849225
• CAZyme ID: MGYG000002894_01259
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000002894_26|CGC1	53840.54	9.9496

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002894	2092236	MAG	United States	North America

• Gene Location: Start: 22305; End: 23744 Strand: +

Full Sequence      

MKRPLSNQKWQIICTLLCTLVAAIVRFARLGVIKILIFDETYYVKDAYALAHLGYEAKWT
KDKDALFNAGDFSALSTDPQFVVHPPLGKYLIALGPKLFGWDSAFGWRFMAALFGTILVA
LTCVIASRLFKSVPITALAGSFVAFDGIAVTLSRTSLLDVFLAVFVLAAFLFIILDYQHI
RGRLSASSPFAGVFFRPYLLCAGVLAGAACAVKWSGVWVLAGLGLTVFGYELAARWRNRR
RVRALFGAICCGGIPAFFQLVPVALGTYLLTWGNWFFGHKGWSAKSPGNHFANWLSYQRE
VYEFHVGLTKDHTYQANALQWIFDLRPTSFAYQKPYGGEGDYLVRAVLALGNPLLWWIGI
IALLWLVYASLRYRQFKYAILAVGYLTTWVPWFLYWDRTIFMFYTVVLVPFIALTVAAFL
GALWKSFPGQATLSVCARVTAAMFVAYISLSALFFLPLATGALIPHSHWQWRMWLQSWI

Enzyme Prediction     

No EC number prediction in MGYG000002894_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	18	276	1.5e-60	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	2.88e-19	11	225	23	221	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	7.94e-12	19	225	4	194	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	5.79e-11	84	425	136	414	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	7.70e-09	292	475	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1807	ArnT	9.19e-05	84	229	64	194	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX81378.1	3.00e-124	16	479	55	547
QIN29095.1	8.72e-111	5	479	60	568
QGS11599.1	6.17e-108	13	479	70	581
QCT34948.1	1.73e-107	13	479	70	581
QEV33171.1	5.24e-106	6	479	68	580

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	2.33e-56	4	478	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.33e-56	4	478	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	4.20e-53	4	478	31	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.62e-46	37	478	63	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9C100	4.17e-10	6	225	48	255	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999986	0.000026	0.000010	0.000000	0.000000	0.000007

TMHMM  Annotations     

start	end
12	33
104	126
133	152
156	175
187	209
214	233
245	267
347	369
376	395
400	422
443	465