CAZyme Information: MGYG000002894_01302

Basic Information

• Species: Winkia sp002849225
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Winkia; Winkia sp002849225
• CAZyme ID: MGYG000002894_01302
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	MGYG000002894_28|CGC1	69211.21	5.4349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002894	2092236	MAG	United States	North America

• Gene Location: Start: 11131; End: 13035 Strand: +

Full Sequence      

MAGQPFLHNLVPTLRVPNQVWADTAGNLDGGAQGIYCYDTRLISRLSLRLTLEGEEVAVE
PLTQLDLESGHTRFVNALRIEGDTADPKILLVRDRVVDIEGVREQMAVQNASSKAFVLTL
ELQVSPDLSSMEKIKSGKPARAVYAKGGKWDDGSAFATWWAPEAKLVESETSFTCCWCLN
LKPNSEEACAWSLQMRDESGQFAASRHAGITAQAQRRKEPQEAAGPRAAQEKVDLWTAVA
ARDLDSLLMGERSRPENSFYAAGAPWFFTLFGRDSIITAWLLRHECPQVGLGTVRALAAR
QGQADRPQTGEQPGKILHEVRRDGLETFDAGGRISLPPTYFGTIDATPLWVRLFVALWRG
GMEGELSPLLQRLQAALEWICTDGDADGDLFLEYVDKSGRGLANQGWKDSGDSIRWADGQ
FAKAPIALCEAQGYAYAALVEGGKLLGEQGVDSEKYAERAEQIREKFTSTFWVGQGADSY
PAIALDAHKQTVTGAASNMGHLLGTGILRADQARAVAERLCQEDLLSPYGIRTLSTSCGA
FHPLSYHCGSVWAHDNGMIIDGMLTEGLDEHARTIASRISRAAERFQFRMPELFGVLPGG
GPFIPPVPYPASCRPQAWAAATAFVSARALRTRN

Enzyme Prediction     

No EC number prediction in MGYG000002894_01302.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	5.63e-68	220	626	230	602	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam14742	GDE_N_bis	1.22e-14	19	141	7	132	N-terminal domain of (some) glycogen debranching enzymes. This domain is found on the N-terminal of some glycogen debranching enzymes and is usually followed by the GDE_C (PF06202) and in this sense it is analogous (but probably not homologous) to the GDE_N (PF12439). Its exact function is unknown
pfam06202	GDE_C	5.07e-14	261	622	22	371	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17389	Bac_rhamnosid6H	4.37e-04	338	475	87	217	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNN52328.1	2.71e-164	2	630	3	618
AUZ33084.1	4.12e-155	1	630	1	633
QDP97248.1	3.70e-152	4	629	5	620
ADX74079.1	1.17e-151	1	630	1	633
SDT32008.1	2.66e-150	4	629	9	613

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002894_01302.