CAZyme Information: MGYG000002897_01245

Basic Information

• Species: Varibaculum cambriense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Varibaculum; Varibaculum cambriense
• CAZyme ID: MGYG000002897_01245
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		36534	9.3357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002897	2017891	MAG	United States	North America

• Gene Location: Start: 7143; End: 8129 Strand: -

Full Sequence      

MRGECQVFAVVVAYNRAKLLRECLDAIAGQVRPVQRVIVIDNASTDDSARIAQQHPVVDR
VIELSENTGGAGGFCAGIAHALAFKELKNQDFIWIMDDDTIPTPDALAQLLEAGQRYPGS
PALLASQAQWIDGSEHPMNAHRERPLLSPDRKRIARRLGLRQVRAASFVSILVEVAQVRR
SGLPIADYFIWNDDLEYTARLLKNRIGLYVPTSVVVHKTRAAAGATDDPGDRFYYETRNK
IWFLLRSRGLLCLDRVLYGGSMLVRWFRMWLSSGEKKKMLRLGVKGVTDGLLSGPRPNEE
IFASDPETAKLVTACENAVQVRADKKHG

Enzyme Prediction     

No EC number prediction in MGYG000002897_01245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	116	1e-21	0.611764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	1.11e-67	9	243	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.13e-39	7	292	5	302	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.79e-22	10	118	2	103	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	7.36e-22	10	160	3	147	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	6.84e-21	9	119	1	107	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ72446.1	2.37e-107	6	320	7	316
ACZ20826.1	1.25e-105	10	311	4	305
AVM61689.1	1.16e-103	7	306	4	300
QUC00015.1	1.69e-103	6	322	64	378
QJW36096.1	2.09e-102	6	322	2	314

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMX2	8.97e-15	7	264	5	274	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	8.97e-15	7	264	5	274	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
A0R5Z2	1.17e-12	7	251	7	254	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002897_01245.