CAZyme Information: MGYG000002898_00159

Basic Information

• Species: Haemophilus_D pittmaniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D pittmaniae
• CAZyme ID: MGYG000002898_00159
• CAZy Family: GT25
• CAZyme Description: Lipooligosaccharide biosynthesis protein lex-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000002898_1|CGC2	29316.93	9.7887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002898	2077686	MAG	United States	North America

• Gene Location: Start: 164497; End: 165255 Strand: -

Full Sequence      

MTQHNFVISLTSELERRQHIRQEFGRHGVDFEFFDAITPANLAETAARLEIDISRSPLTP
GELACALSHLALLQLAKERDLDYICIFEDDIYLGGNAAAFLSADYLNADVMVVKLEKNFE
RIVTQRQPSKTYFGRQFYRLTQVNSGAAGYLVTRRGIDYLLKRIRAIGDIEIDNLLFNFF
LRDKNYVVWQIQPALCIQEAIFKPQQTHFISTIGERERKRPKAPLLIRLYKELKRPFIRL
RKKLFGRISTFQ

Enzyme Prediction     

No EC number prediction in MGYG000002898_00159.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	3	173	6e-34	0.9723756906077348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	2.75e-43	1	247	1	248	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	2.30e-40	3	176	2	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	3.48e-32	4	99	1	101	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV77258.1	5.88e-178	1	252	1	252
AHG75252.1	3.84e-83	5	252	3	253
QLB16086.1	5.44e-83	5	252	3	253
AHG77378.1	7.71e-83	5	252	3	253
AWW34437.1	7.71e-83	5	252	3	253

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05770	1.11e-62	5	252	3	263	Lipooligosaccharide biosynthesis protein LpsA OS=Mannheimia haemolytica OX=75985 GN=lpsA PE=3 SV=2
Q57125	9.00e-58	3	252	32	282	Putative glycosyltransferase HI_0765 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0765 PE=3 SV=1
Q57394	1.90e-36	5	245	4	257	Lipooligosaccharide biosynthesis protein lic2B OS=Haemophilus influenzae OX=727 GN=lic2B PE=3 SV=1
Q51116	9.95e-35	5	199	3	208	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtB PE=3 SV=2
Q50950	2.37e-33	5	199	3	208	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria gonorrhoeae OX=485 GN=lgtE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002898_00159.