CAZyme Information: MGYG000002898_01006

Basic Information

• Species: Haemophilus_D pittmaniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D pittmaniae
• CAZyme ID: MGYG000002898_01006
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		28153.84	10.7611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002898	2077686	MAG	United States	North America

• Gene Location: Start: 97925; End: 98656 Strand: -

Full Sequence      

MRKINIKSLLRLLSLAWWQANWSRLLLRLFAALFALGLIFRFVPIPFSAYMVQQKIDHLF
SGDWRYQVNYSWVPLSQISPNMQLAVIAAEDQKFPQHWGFDFNAIEKALRHNEKSKRIRG
GSTISQQTAKNLLLWHGQSWLRKGLEVPATMMLEGLWSKERILEVYLNIAEFGDGIFGVE
AASRYYFQKPAKNLSASEAALLAAVLPNPHIYKVNRPSALVTKRQHWIQNQMRQLGQSYL
KQL

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	66	232	6.2e-59	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.31e-114	38	242	28	233	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.56e-94	17	236	2	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.58e-66	1	237	9	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.94e-59	64	233	7	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	4.76e-30	73	242	70	238	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV80722.1	1.34e-174	1	243	1	243
AGV11339.1	6.04e-119	8	243	10	246
AXH82351.1	6.04e-119	8	243	10	246
AXP60556.1	8.57e-119	8	243	10	246
QEQ66096.1	1.73e-118	8	243	10	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	1.33e-24	43	236	17	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OQO_A	7.85e-24	72	212	22	163	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.85e-24	72	212	22	163	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3UDF_A	4.90e-21	46	236	20	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
7U4H_A	9.57e-21	69	217	39	189	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44890	7.69e-116	8	243	10	246	Biosynthetic peptidoglycan transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mtgA PE=3 SV=1
A5UDP3	4.61e-111	8	224	10	227	Biosynthetic peptidoglycan transglycosylase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mtgA PE=3 SV=1
Q65S86	4.76e-107	35	243	36	244	Biosynthetic peptidoglycan transglycosylase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mtgA PE=3 SV=1
Q9CNV0	7.52e-102	18	243	17	245	Biosynthetic peptidoglycan transglycosylase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mtgA PE=3 SV=1
A7MJD8	2.97e-88	38	236	32	230	Biosynthetic peptidoglycan transglycosylase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999969	0.000058	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
25	47