CAZyme Information: MGYG000002898_01370

Basic Information

• Species: Haemophilus_D pittmaniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D pittmaniae
• CAZyme ID: MGYG000002898_01370
• CAZy Family: GT41
• CAZyme Description: UDP-glucose:protein N-beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MGYG000002898_7|CGC2	71461.74	6.5023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002898	2077686	MAG	United States	North America

• Gene Location: Start: 126970; End: 128868 Strand: +

Full Sequence      

MTEQQNPSVIQFEKEVAARNYEAACVALLDILTQVDSNFGGIEGIEIDFPQQLNNLPQEQ
IRHFCTRMANATSELFRDPKLEISESGALRFLTLQRWLCMIFASSPYINADHILQTYNRN
PNPENPLDIHIDPSKSSLIKFCIMYLPESNVSLNLDALWNLDPELCASLCFALQSPRFIG
TSEAFGKRGTLLQWFPKYLAQIENLNNLPSAISHDVYMHCSYDIAANKHQVKHALNQVIR
RHLLAGDWTDRDVRKLGERNGKPVMVVLLEHFHSSHSIYRTHSTSMIAARERFHLIGIGN
DAVDEAGRAVFDEFHLIKGNNIFERLNNLKAICEENGAAVFYMPSIGMDMLTIFASNTRL
APVQVIALGHPATTYSDFIEYVIVEDDYVGSEECFSETLLRLPKDALPYVPSSLAPQNIA
YQLRENPELVNIGIASTTMKLNPYFLEALKAIRDRAKVKVHFHFALGQSSGVTHPYVARF
IQSYLGDDATAYPHKPYHQYLSILQNCDMMVNPFPFGNTNGIIDMVTLGLVGVCKTGPEV
HEHIDEGLFKRLGLPEWLIAQTVDEYVERAIRLAENHQERLQLRRHIIENNGLKTLFTGD
PSPLGKVLLAKVDEWKVTNLQTQSSTKKKAKK

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	270	591	4.5e-36	0.41702127659574467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18254	HMw1_D2	8.12e-60	156	243	1	88	HMW1 domain 2. This domain is found in Actinobacillus pleuropneumoniae HMW1C (ApHMW1C). HMW1 adhesin is an N-linked glycoprotein that mediates adherence to respiratory epithelium through N-glycosylation of protein acceptor sites and O-glycosylation of sugar acceptor sites. This domain forms an all alpha domain (AAD) when combined with the N-terminal domain. The AAD interacts extensively with the C-terminal GT-B fold in order to create a unique groove with the potential to accommodate the acceptor protein.
pfam18071	HMW1C_N	1.60e-50	6	151	1	143	HMW1C N-terminal. This is the N-terminal domain found in Actinobacillus pleuropneumoniae HMW1C (ApHMW1C). HMW1 adhesin is an N-linked glycoprotein that mediates adherence to respiratory epithelium through N-glycosylation of protein acceptor sites an O-glycosylation of sugar acceptor sites. The N-terminal domain forms an all alpha domain (AAD) when combined with the domain spanning from residue 154 to residue 245. The AAD interacts extensively with the C-terminal GT-B fold in order to create unique groove with potential to accommodate the acceptor protein.
COG3914	Spy	4.10e-15	353	600	353	601	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV68451.1	0.0	1	632	1	632
QOR23145.1	0.0	4	627	5	629
QOR15805.1	0.0	4	627	5	629
QRP12007.1	0.0	1	632	1	633
QEN10817.1	0.0	1	632	1	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q3E_A	0.0	1	613	12	625	Crystalstructure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3E_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3H_A Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in complex with UDP-GLC [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3H_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in complex with UDP-GLC [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3I_A Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in the presence of peptide N1131 [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3I_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in the presence of peptide N1131 [Actinobacillus pleuropneumoniae serovar 1 str. 4074]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3N2T3	0.0	1	613	1	614	UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=APL_1635 PE=1 SV=1
B3H2N2	0.0	1	613	1	614	UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=APP7_1697 PE=1 SV=1
O82039	3.32e-07	359	589	588	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
Q8RVB2	4.36e-07	359	589	588	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002898_01370.