CAZyme Information: MGYG000002900_00186

Basic Information

• Species: Actinomyces urogenitalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces urogenitalis
• CAZyme ID: MGYG000002900_00186
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	MGYG000002900_3|CGC2	59269.9	4.6226

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002900	2460697	MAG	United States	North America

• Gene Location: Start: 60469; End: 62097 Strand: +

Full Sequence      

MDTTFLDCLVDLRSVPFTTIGSRLLVYRDEADLVVYESAYERPEEASTAARIRLADDGEP
ATVRAVTPAELIMSNGASLTLTPAGSVVLTHLPAGCTVSTEQASLVTRPGDAVVLERGGG
WPADPGLNAHLAPEPELAEARDAVVERTRSWMARCPRPHERWQEMVRQCWWTLGVNTVVL
ETPGAPATAVVPSKIGYLGAWQWDSYFIALGLAWGDPQLAAEQLQLAVRYQRSDGQLPDV
THDGGVLASSADLPPADLARLRELASPSLDGQEVPLTKPPLLALAVDALASHGHAGVRQK
LGEAVRSNLRWWYEHSSRQGLPCYLHPYSSGLDDSPVFDDDALVASPDLASYLIASELTV
ARWEREDGAEAEAHQAEARAQRLTDQLVARWDPHRKMFPAQAEDGRDLAPATVVSLMPLL
VPQLPQDMVEALVRDLTEGGRFATRYRIPTVAIDDPSFSRTRMWRGPVWVNTSWLVCQGL
RRHGYLDLARQIEDELLALVASAGPCEYFTPDTGQRADSATVLFGWSAALAIDIAMRRSQ
EA

Enzyme Prediction     

No EC number prediction in MGYG000002900_00186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	193	532	4.4e-34	0.3631578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	8.17e-11	158	529	243	597	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	1.57e-08	418	529	661	774	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	3.33e-05	414	496	351	446	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO37266.1	5.90e-152	11	539	13	520
AQX16068.1	3.47e-151	11	541	13	566
VEP40606.1	3.47e-151	11	541	13	566
ATG53024.1	1.08e-131	10	541	22	604
VEG27242.1	2.09e-126	10	542	15	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	2.23e-22	191	532	22	416	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	3.18e-21	191	532	22	416	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
6G3N_A	1.00e-15	188	533	29	445	Mycobacterialhydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199],6G3N_B Mycobacterial hydrolase complex 14. [Mycolicibacterium hassiacum DSM 44199]
5OHC_A	1.31e-14	188	533	29	445	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OHC_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OI0_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],6Q5T_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199],6Q5T_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) - apo form [Mycolicibacterium hassiacum DSM 44199]
5OIE_A	7.25e-14	188	533	29	445	Crystalstructure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OIE_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with serine and glycerol [Mycolicibacterium hassiacum DSM 44199],5OJU_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJU_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJV_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5OJV_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with mannosylglycerate [Mycolicibacterium hassiacum DSM 44199],5ONT_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase(MhGgH) E419A variant in complex with glucosylglycerol [Mycolicibacterium hassiacum DSM 44199],5ONT_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase(MhGgH) E419A variant in complex with glucosylglycerol [Mycolicibacterium hassiacum DSM 44199],5OO2_A Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199],5OO2_B Crystal structure of Mycolicibacterium hassiacum glucosylglycerate hydrolase (MhGgH) E419A variant in complex with glucosylglycolate [Mycolicibacterium hassiacum DSM 44199]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	4.66e-23	191	532	88	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	8.38e-23	191	532	88	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	7.13e-14	188	533	27	443	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002900_00186.