CAZyme Information: MGYG000002900_01162

Basic Information

• Species: Actinomyces urogenitalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces urogenitalis
• CAZyme ID: MGYG000002900_01162
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		27776.23	9.5666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002900	2460697	MAG	United States	North America

• Gene Location: Start: 5; End: 805 Strand: +

Full Sequence      

MATGWLQLGSTWYYLDPATGKMATGWLHLGPTWYYLTPSGAMVTGRQVVDGRESAFAASG
AWQGYTTASGAASDAGSRSPAVQHAIMSAPAASRRATTAAMVRAYQRSGATYPAQALGRG
GATSIEAFVGLVYDEAVAEGVSPELLFVQAMKETAWLRFGGDVRVTQLNFGGIGATGGGA
GGASFGSVREGLRAQVQHLRAYADPSVTQAKLAHPVVDPRFAYVRKGSARYVEHLGASEN
PQGVGWATDKGYGTSLAQMMSPIFGI

Enzyme Prediction     

No EC number prediction in MGYG000002900_01162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	132	261	8.7e-18	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033838	PspC_subgroup_1	3.29e-16	1	71	564	643	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG5263	COG5263	8.85e-16	1	62	253	312	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	1.56e-15	1	77	521	591	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.12e-15	1	71	461	540	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.22e-15	1	61	501	560	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD80262.1	1.53e-84	49	265	189	390
ARD41193.1	1.58e-81	49	265	189	390
BAW93920.1	1.04e-79	49	265	190	391
AMD86541.1	8.00e-71	52	265	768	975
QCT35925.1	1.93e-69	49	264	465	686

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	3.21e-15	134	260	77	192	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000009	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002900_01162.