CAZyme Information: MGYG000002900_01169

Basic Information

• Species: Actinomyces urogenitalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces urogenitalis
• CAZyme ID: MGYG000002900_01169
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000002900_31|CGC1	35703.91	5.1193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002900	2460697	MAG	United States	North America

• Gene Location: Start: 9166; End: 10167 Strand: -

Full Sequence      

MSDAVQSSTARPSARIVIVNWKQAALTIRACRSLASQLADGDRLLVVDNASGDGSAEQIR
EAGFEVLEASENGGFAAGVNLGAQGLAEDALVLLNNDAEARPRYLDALLAPLAEPAQSPG
NEPLGATTALLVLSGRWRHALEGEPAETGLDGQRWARVTAQAEARGDGQVLVNSTGNVVD
RYGNGYDRDWLTPLNELDATPEVFGICGGACAIAASAWRQLGGLREDLFMYYEDTDFSYR
LHEAGYGVRFVSEAEALHEHAASSGSDSELFLRVNARNRILVSADHASCPVLAQAIARTS
VRALKELLTQRRRGPVTRGLIEALRRVARRRAS

Enzyme Prediction     

No EC number prediction in MGYG000002900_01169.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.23e-40	11	318	2	279	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.14e-32	16	260	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	9.84e-12	32	259	15	204	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04185	GT_2_like_b	2.46e-10	17	282	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	8.43e-10	16	115	2	106	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALC99722.1	1.02e-129	7	320	11	316
QQM66999.1	8.51e-122	11	333	38	352
VEG52619.1	1.20e-121	11	333	17	331
QPL05822.1	4.44e-120	11	325	3	308
QQC21446.1	3.26e-119	11	329	7	336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002900_01169.