CAZyme Information: MGYG000002900_01823

Basic Information

• Species: Actinomyces urogenitalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces urogenitalis
• CAZyme ID: MGYG000002900_01823
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760	MGYG000002900_68|CGC1	83591.51	4.7823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002900	2460697	MAG	United States	North America

• Gene Location: Start: 7652; End: 9934 Strand: +

Full Sequence      

MKFSNGYWLDREGYQVEKARGLLDLGPTTDDGATALRAYAPVRPVTGRGDTLNNPLLTAT
FTAVADGVIKVSLVNHAGRRDPGPHFEVTSEPGYSGVVQAEGSGLTLRAGDLAVHLEEGA
DWTARFTHAGKELTTSLPRAVAHVVAPDGQTYMREQLSLRPGERVYGLGERFGALTKNGQ
SVDIWNEDGGTASEQAYKNIPFYLTTAGYGVFVDNPGGVSFEVGSELTTRTQFSVEGERL
TYYVIDGPTPKDVLRRYTALTGRAPMVPTWSFGLWLTTSFTTSYDEETVTGFVDGMAQRN
LPLSVFHFDCFWMRGFHWSDFEWDPATFPDPAAMLERMKAKGLKICVWINPYIAQRSALF
TEGAAKGYLVRKTNGDIWQTDLWQAGMALVDFTNPDAVAWYRSKLAGLLEMGVDCFKTDF
GERIPVRDIAWHDGSDPERMHNYYTHLYNRTVFDLLSEVRGEGEAILFARSATAGGQQFP
VHWGGDNESTYASMGETLRGGLSLTSSGFGYWSHDIGGFEGTPDPGVFKRWLAFGLLSSH
ARLHGSSSVRVPWAFDEESVDVARRFINLRLSLMPYLYAAAREAHETGTPMMRSMFLEFP
GDRGAWDVDTQYMLGSDLLVAPVMDAEGEADVYLPEGTWTSYWTGQSVQGPRWVHEKHGV
ESLPLYVRQGAALALAGSITRPEEDWREGLTVRVEALAEGDERVVTVPAHDGCEEASVQV
VRQGQVLRATATGLSGSWSLVSGGQRVDGEGETTVELTVA

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	242	672	6.7e-141	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10658	PRK10658	0.0	1	670	1	665	putative alpha-glucosidase; Provisional
pfam01055	Glyco_hydro_31	0.0	243	673	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06593	GH31_xylosidase_YicI	0.0	262	573	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	0.0	8	722	1	717	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10426	PRK10426	2.69e-82	161	650	80	601	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPL05315.1	0.0	1	759	1	755
CED90695.1	0.0	1	757	1	763
VEG27826.1	0.0	1	759	1	756
VEG74546.1	0.0	1	747	1	744
ACU84032.1	0.0	1	675	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	2.33e-278	1	740	1	736	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	2.77e-278	1	740	1	736	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.34e-264	2	740	2	736	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	2.37e-113	160	675	199	717	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	4.01e-80	79	675	160	804	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	1.23e-277	1	740	1	736	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	4.86e-251	1	694	1	717	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	2.61e-238	1	736	1	736	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	2.75e-81	163	694	147	694	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	2.79e-71	151	694	99	643	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000018	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002900_01823.