CAZyme Information: MGYG000002901_00319

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus
• CAZyme ID: MGYG000002901_00319
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		50988.91	4.6074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002901	1162260	MAG	United States	North America

• Gene Location: Start: 4; End: 1299 Strand: +

Full Sequence      

MLEKRGVIEGFYGIPWSFEERMSMIKFLFDIEMNQYVYAPKDDPYHNVKWREPYPDEKLA
EISKLAELSRNKGVDFVWAIHPGQNLIDFNLYEEEIDKLFKKYDSLHEAGVTSFALCMDD
IDRDLAYEQREFHLRLVKDILKKLETYENGKLLFVHPWYNSAWIDEKGEEYFKLFSGLDR
LEILWTGYDVVVPITKASQEKFTELSQKEANIWFNWPVNDYLRDRIFMEVFEFYDSSEIN
YKSILSNPMNQAELSKISIYQIGEFAKDPSGFVPIESFKRALAYIDEKVASELFIIADSF
FASGVYDRFDDKKYKEDGEIALAYRDKNFEEVKSLLDKKIGAIDSYFKNYSNDKLYEEVK
PFFTSLSYLSEAVKAVIDKDFKKASSFYDKCSDCKVKIYKEFSLDTIEDRKVKTSRVLEK
IYEELMEDVEK

Enzyme Prediction     

No EC number prediction in MGYG000002901_00319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	5	297	5e-89	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	6.70e-104	5	292	1	288	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV28200.1	2.07e-284	1	431	1	431
APC49528.1	9.39e-72	5	377	127	512
AIY84741.1	4.06e-71	3	412	195	624
ASK62202.1	1.27e-69	5	407	192	612
APC49529.1	3.33e-67	5	297	185	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	3.14e-58	5	388	180	582	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
2J4G_A	2.59e-53	5	293	129	417	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	2.62e-53	5	293	130	418	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	2.62e-53	5	293	130	418	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	2.62e-53	5	293	130	418	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.80e-52	5	293	151	439	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	2.66e-43	5	298	182	480	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.66e-43	5	298	182	480	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	5.99e-34	5	292	187	490	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	5.24e-29	6	267	63	333	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002901_00319.