CAZyme Information: MGYG000002903_00595

Basic Information

• Species: Negativicoccus succinicivorans
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Negativicoccaceae; Negativicoccus; Negativicoccus succinicivorans
• CAZyme ID: MGYG000002903_00595
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000002903_24|CGC1	21737.22	4.8892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002903	1204906	MAG	United States	North America

• Gene Location: Start: 2815; End: 3411 Strand: +

Full Sequence      

MNPAKKQLLLLPGSRRQEVQSLLPTMLDAAALLAKEFPLQCWLPRASTISEAELAPLLAE
TELDIQMTTSHLHDLMTVCDAALAASGTVTLETALLGLPTVLCYKVAPLTYWLGRRVLQT
PHIGLPNIVAGREVIPEFLQQDVTAENLARAVASWWRDEEASRRLRDDLAMVREKLGAPG
AVGRVADLIIRIAEENND

Enzyme Prediction     

No EC number prediction in MGYG000002903_00595.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	176	1.1e-54	0.4830508474576271

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.57e-69	3	196	184	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.68e-58	2	195	185	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.68e-41	3	151	183	334	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	3.83e-22	3	151	165	312	lipid-A-disaccharide synthase.
PRK01021	lpxB	4.03e-11	73	152	483	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV60281.1	2.56e-53	6	195	186	376
ARF98938.1	1.42e-52	3	198	183	379
SNU95574.1	7.91e-52	6	195	186	376
ACZ24221.1	7.91e-52	6	195	186	376
QQB16511.1	7.91e-52	6	195	186	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.49e-22	8	194	194	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.24e-21	8	194	194	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	3.55e-48	1	192	187	379	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	2.94e-46	10	196	196	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	3.26e-45	1	192	187	379	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q3JAC1	3.11e-42	2	197	187	382	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q3A550	1.15e-38	1	195	189	384	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000096	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002903_00595.