CAZyme Information: MGYG000002905_01310

Basic Information

• Species: CAG-279 sp900541935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541935
• CAZyme ID: MGYG000002905_01310
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002905_29|CGC1	43107.66	8.704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002905	2448974	MAG	China	Asia

• Gene Location: Start: 8986; End: 10089 Strand: +

Full Sequence      

MEKRLCLVYNYAQHYRQEIFQLLDKELNCDFYFGDKMGDVKKLDYNLLNNFQAELENHRI
GKSFYYQKGINKCLRKNYTDYIFLGEVRCLSTWWALIYCKFSKKNIHLWTHGWYGKESFL
EKTLKKAFYSLADNILLYGDYAKQLMIKEGFNSKKLHVIYNSLAYDKQKSLRNNLKIKDI
YASHFRNNNPNLVFVGRLTKVKKLDFIIRAVADLRKKGENYNLTFVGTGEEKEVLLNLSK
ELNAEDVVWFYGACYDEEKLAELLYNADLCVSPGNVGLTAMHSMVYGLPVLTHNKFEWQM
PEFEAIIEGKTGSFFEYDNLKSLETSISGFFKNVTDRETIRKNCFAVIDSKFNPHIQLNV
IRNVLEI

Enzyme Prediction     

No EC number prediction in MGYG000002905_01310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	185	334	1.8e-20	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	2.64e-22	95	366	101	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	3.43e-22	106	367	112	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	5.09e-22	192	343	5	154	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	3.52e-21	74	292	79	291	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03817	GT4_UGDG-like	1.58e-19	124	319	140	328	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEL26820.1	5.92e-151	6	365	5	364
APU95299.1	6.00e-138	1	360	6	366
AWW33290.1	5.19e-128	23	365	1	344
QUT39995.1	3.48e-124	3	367	2	369
ASK30376.1	1.10e-123	7	365	9	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6N1X_A	5.17e-06	133	356	125	362	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	5.41e-06	133	356	141	378	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58469	4.01e-11	119	366	147	388	Uncharacterized glycosyltransferase MJ1069 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1069 PE=3 SV=1
Q48453	2.67e-10	119	319	128	311	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
O05083	8.54e-09	189	333	181	322	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q59002	1.27e-06	155	291	173	311	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002905_01310.