CAZyme Information: MGYG000002905_01826

Basic Information

• Species: CAG-279 sp900541935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541935
• CAZyme ID: MGYG000002905_01826
• CAZy Family: GH144
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733		83330.16	6.6494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002905	2448974	MAG	China	Asia

• Gene Location: Start: 172; End: 2373 Strand: +

Full Sequence      

MKKIMLFAMAMLSGMAFAVEKPYDYVSFENSRMDGDYFYSKAEYTSPSWIENSQKKLPVD
NDCFSPGNSLRLRYVAAYSGDWTASVLYCPVRGNDFFRHPDVLAFNLKYADSDAATLPVV
GIQYADSTRSKFVDVAKYVKPFKDGWSRVEIPLNDMGVALGEKNAKTMGASNFFNVSEIE
VAEIKKISAVIFKQGAADGKEHTLNIDDVELLPKASEKALLQAPEVFECKGYERHIDLRW
KGESKGLRYYKIYRSLNGGEFKAVGIVKPWSDRYSDFIGEVGAKASYKVSAVDYGFNESA
CSNVVSSSTRPMTDDELLDMVQEANFRYYWEGAEPNSGLARENIPGRSDMIACGASGFGI
MTMLVGIDRGFITREQGIERFLKITSFLEKADRFHGAFAHFMDGTTGKVVPFFGKRDNGG
DLVETSFLFHGLLAAHQYFDGDSKEEKLIRSRINKLWRECEWNWYKKAKDSKYLFWHWSP
DQEWVISHPLIGWNETLITYMISIMSPTHAIEPEMYYSGWASQEKMAQDYRLWGNSQYGL
HYTNGNTFFGRKLDVGVSNGGPLFFVHYSFLGLNPHKFNDRYTNYFENSRNIALINHRYC
VENQGGFQGYGSDCWGLTASDYAWGYDAREPVPAHDNGTIAPTGALASMPYTPEESLAAL
KNYYRNYGKFLWGEYGFHDAFNLTQNWVSPIFMGLNQGPVAVMIENYRSQLVWNLFMSHP
DVQKGLKKFSKIK

Enzyme Prediction     

No EC number prediction in MGYG000002905_01826.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH144	312	729	6.4e-171	0.9826732673267327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5368	COG5368	8.77e-105	310	728	6	427	Uncharacterized protein [Function unknown].
pfam10091	Glycoamylase	7.89e-81	487	720	1	215	Putative glucoamylase. The structure of UniProt:Q5LIB7 has an alpha/alpha toroid fold and is similar structurally to a number of glucoamylases. Most of these structural homologs are glucoamylases, involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity.
COG3401	FN3	0.001	209	339	157	285	Fibronectin type 3 domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT97401.1	0.0	1	733	1	721
QUT52134.1	0.0	1	733	1	721
AST55733.1	0.0	1	733	1	721
EFK64929.1	0.0	1	733	1	721
QIX65029.1	0.0	1	733	1	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z06_A	0.0	19	733	2	704	Crystalstructure of beta-1,2-glucanase from Parabacteroides distasonis [Parabacteroides distasonis ATCC 8503],5Z06_B Crystal structure of beta-1,2-glucanase from Parabacteroides distasonis [Parabacteroides distasonis ATCC 8503]
4GL3_A	1.72e-141	310	728	11	412	Crystalstructure of a putative glucoamylase (BACUNI_03963) from Bacteroides uniformis ATCC 8492 at 2.01 A resolution [Bacteroides uniformis ATCC 8492]
5GZH_A	3.97e-141	306	728	18	432	Endo-beta-1,2-glucanasefrom Chitinophaga pinensis - ligand free form [Chitinophaga pinensis DSM 2588],5GZH_B Endo-beta-1,2-glucanase from Chitinophaga pinensis - ligand free form [Chitinophaga pinensis DSM 2588]
5GZK_A	5.93e-141	306	728	38	452	Endo-beta-1,2-glucanasefrom Chitinophaga pinensis - sophorotriose and glucose complex [Chitinophaga pinensis DSM 2588],5GZK_B Endo-beta-1,2-glucanase from Chitinophaga pinensis - sophorotriose and glucose complex [Chitinophaga pinensis DSM 2588]
3EU8_A	1.04e-135	307	728	11	423	Crystalstructure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343],3EU8_B Crystal structure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343],3EU8_C Crystal structure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343],3EU8_D Crystal structure of putative glucoamylase (YP_210071.1) from Bacteroides fragilis NCTC 9343 at 2.12 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6LGF6	0.0	1	733	1	721	Exo beta-1,2-glucooligosaccharide sophorohydrolase (non-reducing end) OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_3064 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.999047	0.000162	0.000167	0.000155	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002905_01826.