CAZyme Information: MGYG000002907_01247

Basic Information

• Species: Anaerosporomusa sp900542835
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Sporomusales; Acetonemaceae; Anaerosporomusa; Anaerosporomusa sp900542835
• CAZyme ID: MGYG000002907_01247
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000002907_10|CGC1	43019.87	6.2386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002907	3559920	MAG	United States	North America

• Gene Location: Start: 77368; End: 78546 Strand: +

Full Sequence      

MNSKYMVLLLLLALFSALLLPAQAMAATAAGSSGTGLVTSVMAFFGDIVNGLLNIKPAEP
AAVIPAPAASPRPASGKEVIGFYAEWWGNDTSSYNDMVKHKGAIGTIAPFWATLNRDATV
SDRGGNDHAAVVSYARANGIQTLLLVNNEKGTGTVKPVHTVLSSPALRKKAIDNLEAYIK
QYRLDGINIDFEEVPGGDRDHLTAFMRELADRLKPQGYLVTIDVFPKHNEEADIARAYDY
AKLAAIADKIMLMTYDYHGAWSGPGAVADIAAVERDLQYALRFIPKNKLYLGVPGYGYDW
SDKGVESLEYSAVQALVSRYKPSVQWDDATKSPHFAYTDANGSSHTVWFENSHSLRFKLD
LVNKYDLAGIALWKLGEEDQAFWPLLQSYFRQ

Enzyme Prediction     

No EC number prediction in MGYG000002907_01247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	77	379	1.8e-50	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	6.94e-116	76	386	1	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.83e-72	78	390	103	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	4.25e-39	80	383	3	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	9.51e-35	79	376	2	305	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.03e-34	78	376	1	332	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBB91964.1	5.60e-173	2	388	3	384
QJW45733.1	3.26e-157	2	392	3	396
QJW45758.1	3.26e-157	2	392	3	396
QDR80548.1	1.69e-153	74	391	93	410
AIF52635.1	6.25e-151	32	388	34	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.64e-47	126	375	54	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	4.55e-46	79	392	4	316	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3J_A	2.33e-38	107	390	136	425	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	1.64e-35	133	391	161	428	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4WIW_A	2.49e-34	107	391	37	349	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	6.64e-46	126	375	146	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	2.71e-43	90	388	38	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	1.23e-38	107	390	135	424	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.21e-37	107	390	135	424	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	1.06e-32	108	390	128	423	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.998912	0.000223	0.000193	0.000187	0.000171

TMHMM  Annotations     

start	end
7	29