CAZyme Information: MGYG000002909_00405

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella
• CAZyme ID: MGYG000002909_00405
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		30201.97	4.3374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002909	1190953	MAG	United States	North America

• Gene Location: Start: 34928; End: 35707 Strand: -

Full Sequence      

MKVYYNDRGFQLGNLLFVLMQAHKDRLAGIEESYVLRTGYFKFAQSFFPKTAELFGKAQG
CELEPFGYYQISGQDYYAEVLDSFCREYLLERAEELSNQFDNKNITIAIRRTDFLDGDRV
EKYGYDAVKYVVDCLEIIKEKEADISDLTIRITSDDTTWCKEELAPKLKVLFSFSNEIVV
EDQDIQDNFLQLYATDKYFITPNSTYGYWVGYVLRVSGKNVQTFAPNFNTTLIEDGRQIA
DTRDWILVDVDRSMYEEKA

Enzyme Prediction     

No EC number prediction in MGYG000002909_00405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	66	216	9.1e-18	0.5144927536231884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	6.65e-09	2	212	32	239	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	8.94e-06	30	226	102	275	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI38019.1	1.54e-172	1	256	1	256
APF40446.1	4.99e-10	3	253	22	271
QNS42744.1	1.31e-09	102	250	4	139
QXW92852.1	1.18e-08	3	229	15	245
ABJ60519.1	1.85e-08	94	249	169	313

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002909_00405.