CAZyme Information: MGYG000002909_00757

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella
• CAZyme ID: MGYG000002909_00757
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41958.72	9.65

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002909	1190953	MAG	United States	North America

• Gene Location: Start: 21674; End: 22768 Strand: +

Full Sequence      

MKRILLITGSFGNGHLQVSKNVREIFEKYYGDKVTVIESDLFLQAHPNLTSVLKKLYLYS
FSYFRDIYGYLYYAGRNQSDISVYRYFSYEYLKRLMKEVKPDIIISTFPTPALSLLKNKK
IPIVNIITDYHFHKSWLTKGAFRYYVATNDTEKELLKLGVEKNKIKKFGIPIAEKFDDIL
DVDSWLKDNGLSTTKNTVLLSAGAFGVSTDFAMLIEQLKKKSNDVQVVVICGKNKKLKNE
LDYKYSRDKDVKIFGYTENMCEWMKSSSVLITKAGGVTISEALASNIPLILFNPVPGQEM
ENARYFKKHNMAKIAKNQEEVLKYVEQLLSKDNIEKMKSNMRGNYLPKASYNICEDIMSY
LDSI

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	198	343	2.8e-29	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13608	PRK13608	1.70e-133	2	363	6	371	diacylglycerol glucosyltransferase; Provisional
cd17507	GT28_Beta-DGS-like	3.50e-104	4	363	1	364	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	2.50e-99	2	358	5	366	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	9.40e-56	3	355	1	349	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PLN02605	PLN02605	5.38e-46	12	357	9	375	monogalactosyldiacylglycerol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX87611.1	1.81e-235	1	364	1	364
VEI38977.1	2.30e-197	1	362	1	362
AME09191.1	3.51e-149	2	361	3	363
AXI26824.1	5.76e-148	2	361	3	363
QGS08019.1	6.89e-147	1	362	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	1.25e-29	2	357	6	380	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49WE6	1.08e-107	2	362	6	370	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1
Q2YWW6	1.99e-105	2	361	6	369	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=ugtP PE=3 SV=1
Q4L524	1.99e-105	2	363	6	371	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=ugtP PE=3 SV=1
B9DQ98	3.99e-105	2	362	6	370	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1
Q2FI60	8.00e-105	2	361	6	369	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002909_00757.