CAZyme Information: MGYG000002913_00983

Basic Information

• Species: UMGS1052 sp900548115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS1052; UMGS1052 sp900548115
• CAZyme ID: MGYG000002913_00983
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		70644.8	4.2218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002913	2137677	MAG	United States	North America

• Gene Location: Start: 447; End: 2345 Strand: -

Full Sequence      

MEKGYLIVNVTAAGVRLPVENARVSISVRQYRPAGDYEERVTADMESSEAYDDRQMTDSS
GRTQSLVVDAPDRELSYIEEGGAVPFSLCDVLVEKEGFFSSAFFGVQIFAARESILSVAL
TPFDESFVNRNTPIEGQSGETQVFEIPDPVVRDGREEAENDETDENAQQTGFSRRDPVKP
AVLPAPYIPENITVHLGRPSQNAQDVTVTFRDYIKNVASSEIYPTWPESTIRANVYAQIS
IALNRIYTEWYPSQGYRFQITNSTSVDQAFVNGRNIYDNIGQIVDEIFNTYLSREGFDEP
LFATYCDGNRTTCAGMSQWGSFELGQAGYTPTEILRTYYGDNVKLVSTDDIRGVASTYGG
VPLAVGQIGPDVREIQNQLNRVREDYPLIPRINAIDGIFGTDTDAAVREFQRIFNLTVDG
VVGKATWYRLSFVYVSVTRLAELTSEGRRAELLTIDTLEVLSIGDMGGQVSTLQYLLEFI
SMYYNTVSSVAIDGRFGVATRNSLIGFQRTFGLTETGTTTRETWEMLVQVYETIIALAFP
LESDQYFPGDLSYGSRGDAVLRMQRYINAISQYYEGVSALVEDGIFGPGMQNVVREIQRR
LVTDVTGVIDSVTWYRIVELYNYIVRTTGTQT

Enzyme Prediction     

No EC number prediction in MGYG000002913_00983.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3409	PGRP	1.13e-15	324	509	1	165	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam01471	PG_binding_1	6.53e-15	369	430	2	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.22e-11	351	430	109	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam01471	PG_binding_1	1.85e-06	556	617	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
TIGR02669	SpoIID_LytB	2.57e-06	197	339	101	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPJ86275.1	4.49e-105	1	446	1	413
ASW42008.1	8.93e-103	3	455	4	432
SQI05872.1	8.78e-98	29	445	15	414
AQW28170.1	8.78e-98	29	445	15	414
QUD73036.1	8.78e-98	29	445	15	414

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002913_00983.