CAZyme Information: MGYG000002914_00579

Basic Information

• Species: Parolsenella sp900552935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella sp900552935
• CAZyme ID: MGYG000002914_00579
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000002914_13|CGC1	35114.01	6.2991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002914	1503585	MAG	United States	North America

• Gene Location: Start: 20760; End: 21710 Strand: +

Full Sequence      

MASVCASPENRKSVAAVVVTYNRKDLLLECLDCLCKQDLGALGERYGLSVIVVDNASTDG
TEEALASLVESGKIAYFNTGENLGGAGGFNYGMRKAVELGHDFVWVMDDDCMTHPDTLRE
FLIAGEGLNGEYGYLTSVCLWTDGTPCSMNRQRHPLHHTIEDFTPELQPCTLASFVSLFV
PADVIAELGLPIKDFFIWTDDWEFTRRVSRKYPCYVVGTSVVTHKCKVNGAGNVAIDSGE
RIARFRLAYRNDIVLYRGEGPAGYAYVAARDLNHLWRIVTEAKGRKLERARAVLGGTFEG
LRFHPAIEYVKRPEKR

Enzyme Prediction     

No EC number prediction in MGYG000002914_00579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	16	122	1.5e-23	0.5823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	7.93e-58	16	255	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.52e-32	10	292	1	282	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	3.26e-14	50	225	29	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.88e-13	50	122	30	100	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	7.57e-13	50	217	29	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50145.1	8.21e-201	6	315	7	316
QGS04883.1	4.89e-108	11	311	3	296
QYA52275.1	4.89e-108	11	311	3	296
QTE72697.1	6.06e-104	12	310	3	295
QUA52465.1	2.45e-103	12	310	3	295

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	3.05e-13	14	226	7	220	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	1.19e-11	12	210	3	200	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	1.19e-11	12	210	3	200	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002914_00579.