CAZyme Information: MGYG000002920_00348

Basic Information

• Species: CAG-485 sp900550645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900550645
• CAZyme ID: MGYG000002920_00348
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000002920_20|CGC1	34465.26	8.318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002920	2230487	MAG	United States	North America

• Gene Location: Start: 3629; End: 4567 Strand: -

Full Sequence      

MTPLSAHSHLRRTALAAMVILLCTCFVSVVTAAPKGGKKKGNSQYIDYIERFAPLAIEQM
KQAGIPASITLAQGLLESSAGMSTLAREGNNHFGIKCGNWIGPSMLRDDDAPDECFRVYS
SAAESYADHSRILKAKRYKRLFDLAPGDYAGWARGLSECGYATDPNYADRLVTIIELYGL
TRYDSGAADVDDVVQFIFGALQSSHAVRRSRSLHYVVAAPGDTYLAIAREFNMKVTDLLR
YNDAERDGEIKAWEEVYLQEKHKDAPSGQKKVTIGEGESMHSIAQRFGMQLSTLRRLNPK
AKDRPGTVLLLH

Enzyme Prediction     

No EC number prediction in MGYG000002920_00348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	53	180	1.8e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.98e-35	16	187	11	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.99e-34	47	184	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	2.75e-26	53	129	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	2.14e-25	47	184	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	2.33e-21	47	175	150	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBW22044.1	2.30e-80	20	303	5	287
AKA51347.1	2.30e-80	20	303	5	287
ALB75916.1	2.30e-80	20	303	5	287
CAH07137.1	2.30e-80	20	303	5	287
QUU02268.1	2.30e-80	20	303	5	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	1.69e-11	47	176	5	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.25e-11	47	176	5	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.06e-11	48	175	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.18e-11	48	175	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	7.52e-11	65	184	80	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	7.08e-17	45	184	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	4.54e-13	47	303	182	462	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P58231	1.81e-10	61	176	165	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	1.81e-10	61	176	165	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P15931	3.36e-10	33	176	146	295	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999159	0.000156	0.000157	0.000149	0.000127

TMHMM  Annotations     

start	end
13	32