CAZyme Information: MGYG000002920_00503

Basic Information

• Species: CAG-485 sp900550645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900550645
• CAZyme ID: MGYG000002920_00503
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		41321.58	7.5091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002920	2230487	MAG	United States	North America

• Gene Location: Start: 13622; End: 14773 Strand: +

Full Sequence      

MVWRTMTLLLLPLLAVTVACSSPHRPSSDRTEAAAVDSAAVADSLLRVRADSAVRALTPE
QRAGMLLMPAMFTRHDAPTLRQLRHYALDTHAGGIVLLRGDTLSARIIADTLRSMGRADM
ILSIDAEWGLGMRLEDAPSYPVNGELATYASERLMRSYGSRVAQQCRRLGINMVLGPVVD
VVPEGGQSIMSRRSFGADPARVARLASAYARALEEGGVISVAKHFPGHGSVPEDSHRTLP
VLYKSLHLLQSQDLLPFRIYVDSGMSGIMVGHIAVPAVDPDIQPAAVSAAVITDLLRNDM
NFQGLILTDALNMGGAEGAPAWKAVAAGADLVLAPADTDAARRDILAAIERGDLTQAEVD
AHCRRIFYYIYKLRSPRRRCAAE

Enzyme Prediction     

No EC number prediction in MGYG000002920_00503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	119	333	9.1e-51	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.96e-58	57	373	1	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.47e-55	58	366	1	313	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	5.44e-36	155	333	81	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	7.28e-09	170	366	150	349	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35538.1	5.03e-71	51	373	43	367
QUB43560.1	3.85e-70	51	373	45	368
AOH41095.1	3.37e-68	51	371	45	371
AVV52804.1	3.37e-68	51	371	45	371
QUT89657.1	3.19e-67	42	377	33	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.58e-41	55	366	9	333	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	6.84e-41	88	367	54	343	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]
6JTI_A	2.34e-31	88	333	65	323	Crystalstructure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_B Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_C Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_D Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_E Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_F Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTJ_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTK_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTL_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae],6JTL_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae]
3BMX_A	3.23e-31	48	366	33	389	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
5BZA_A	8.14e-31	94	313	31	249	Crystalstructure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_B Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_C Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5BZA_D Crystal structure of CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_A Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_B Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_C Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana],5C0Q_D Crystal structure of Zn bound CbsA from Thermotoga neapolitana [Thermotoga neapolitana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9JVT3	2.73e-32	88	333	29	287	Beta-hexosaminidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=nagZ PE=3 SV=1
Q9K0Q4	1.93e-31	88	333	29	287	Beta-hexosaminidase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=nagZ PE=3 SV=1
Q7NWB7	2.48e-31	93	340	31	293	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
A9M1Z4	2.67e-31	88	333	29	287	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1
Q5FA94	7.08e-31	88	333	29	287	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000101	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002920_00503.