CAZyme Information: MGYG000002920_00958

Basic Information

• Species: CAG-485 sp900550645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900550645
• CAZyme ID: MGYG000002920_00958
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		32094.34	8.5548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002920	2230487	MAG	United States	North America

• Gene Location: Start: 84; End: 962 Strand: +

Full Sequence      

MGKYGSPAGIVKLCRRLSVQYDIDTYADLHDVLRTKIMRLVFRLKGVKTAHIDKHRKARR
ALTRPNDKNLVPLTPVSVLYADVFSRLRICRDKSFVSLFGADDAPAGMIAPIVGEGVEKQ
PDEVWIAIAPFARHPGKVYPLEHTHKVVEHFAAEPSVRLFLMGAGAEEQAVLDEWCAGRD
NITNVAAKKAGIAAEIALLSHCDVLLSMDSANMHLASLVGCPVVSIWGATHPYTGFYGRC
QPEDNAVQLALPCRPCSIYGNRPCRRGDYLCLNGLSPEVVIARINRVCAMAH

Enzyme Prediction     

No EC number prediction in MGYG000002920_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	12	266	1e-32	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.90e-29	121	286	118	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	6.10e-18	2	286	62	328	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	4.76e-15	126	262	108	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.46e-05	125	230	185	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37124.1	2.17e-88	3	287	64	345
QQR08225.1	9.41e-82	3	287	71	351
ANU64408.1	9.41e-82	3	287	71	351
ASB37493.1	9.41e-82	3	287	71	351
AGB28723.1	1.85e-81	3	286	81	361

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002920_00958.