CAZyme Information: MGYG000002922_00032

Basic Information

• Species: RC9 sp900541925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900541925
• CAZyme ID: MGYG000002922_00032
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002922_1|CGC1	40528.93	6.4138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002922	2264361	MAG	United States	North America

• Gene Location: Start: 31964; End: 33061 Strand: -

Full Sequence      

MKRTLLTLASIGLLSVCATAQIKEDFKPSELNQPGQEYPMVNSQGYARFRVKAPQAQSVV
VSLGLGGQGGTVLTKGEDGFWTGTTAGPMDEGFHYYHLTIDGGVFNDPGTLNFYGSTRWE
SGIEIPAADRDFYALKNVPHGNVQQILFYSKSTDSVRRAFVYTPPCYEQGKEDYPVLYLQ
HGWGEDETAWSNQGHANLIMDNLIAEGKIKPFIIVMTYGMTNDAVFGQIHKFDFTRFQTV
LVDELVPYVDSHFRTKADKAHRAMAGLSMGGMETKVITLARPEMFSRYALLSGGTYSPSD
IKDKGQVDLIFMSCGSKENPDGVRKAAEEMKNAGFNAVGYVSEGTAHEFLTWRRSLYQLA
PLLWK

Enzyme Prediction     

No EC number prediction in MGYG000002922_00032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	150	361	6.8e-51	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02858	E_set_Esterase_N	2.01e-36	45	126	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	1.26e-28	136	365	62	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	3.15e-17	150	293	1	143	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	7.52e-13	139	327	7	213	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
cd11294	E_set_Esterase_like_N	1.08e-10	49	126	5	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE16001.1	3.04e-202	6	365	10	373
QEC66347.1	9.92e-202	1	365	1	368
QHV98520.1	7.70e-200	2	365	3	372
QTE61413.1	7.98e-200	5	365	9	372
QTE41132.1	7.98e-200	5	365	9	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	7.40e-150	24	365	2	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	7.66e-150	24	365	2	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	1.63e-94	10	365	16	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
7B5V_A	6.89e-86	32	365	33	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	1.01e-81	28	365	8	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	9.50e-165	23	365	379	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	2.44e-65	21	365	311	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	2.84e-31	138	362	46	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P31471	3.22e-26	34	365	35	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P51584	2.87e-08	161	304	845	990	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.326499	0.672844	0.000139	0.000141	0.000116

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002922_00032.