CAZyme Information: MGYG000002922_00046

Basic Information

• Species: RC9 sp900541925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900541925
• CAZyme ID: MGYG000002922_00046
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000002922_1|CGC2	43168.42	6.971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002922	2264361	MAG	United States	North America

• Gene Location: Start: 48075; End: 49217 Strand: -

Full Sequence      

MRYYLIAGEASGDLHGSNLIRGLAAEDPQAEFRFWGGDLMREAAEEHDAPFTLVHHYRDG
AVMGLAEVLSKGFRLLENLHGCEKDIMEWKPDVVILIDYPGFNMKVAKFCHARGQKVFYY
IAPKTWASREGRNRQLKELVDRLFIVFPFEVPYFTARGIPFTYEGNPLVDAVDSHNYSRP
ETDKYIALLAGSRKAEISRMMPVLMQMADRLAGTAEYRDWKFIIAGAPARGESDYTKYIG
GRKNVRLIFDRTYDILKYAEAAVINSGTASLEAALIGTPQVVGWNTSPLTWFAARHILKV
QDHIKYISLGNLCLDRQVFKEYIQDDFTPESIEKEIRRILEDGQYREEMLQGYAQIRESL
GGSGASRKVAAAMIKELKTQ

Enzyme Prediction     

No EC number prediction in MGYG000002922_00046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	1.8e-102	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.04e-105	1	380	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.00e-104	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.36e-74	4	374	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.14e-62	5	374	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.17e-50	58	377	46	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	3.59e-109	1	379	1	372
ANW95466.1	5.44e-108	1	375	1	367
ASW75777.1	3.10e-107	1	375	1	366
ADY31424.1	6.26e-107	1	378	1	374
SNV26174.1	6.26e-107	1	378	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.58e-40	5	360	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.58e-40	5	360	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	5.51e-76	2	370	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	4.97e-74	2	377	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	1.39e-73	2	380	8	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	1.85e-70	2	377	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.48e-67	5	378	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002922_00046.