CAZyme Information: MGYG000002922_00903

Basic Information

• Species: RC9 sp900541925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900541925
• CAZyme ID: MGYG000002922_00903
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292	MGYG000002922_7|CGC1	33001.69	9.0242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002922	2264361	MAG	United States	North America

• Gene Location: Start: 9649; End: 10527 Strand: -

Full Sequence      

MIKRFLVFAAGLLLAAASSCGQTESELHKQPPRVPEKVVFAGQTIRFDRSDLYERMDREL
IAFTYMHTNSTLLLKKSERIFSQVVPVLRREGVPEDLKYLMAIESNLDPKSVSSAGAAGL
WQFTKSTAREYGLEVSAEVDERYNIEKSTKAACDYLKKAYAKYGDWMTVAASYNGGQNGI
TRKLADQRQTSALDLWLVEETSRYMFRVLAAKMFFERPSDFGFDVPHSERYPYYPPAKTV
EVSGPIENLVDFAEENGISYAQLKGANLWLRDSKLLNKAGKTYSIIIPRAGR

Enzyme Prediction     

No EC number prediction in MGYG000002922_00903.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	88	211	1.6e-23	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	5.50e-60	88	213	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.54e-24	88	185	6	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	2.20e-22	94	267	118	292	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	4.22e-17	100	211	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	8.51e-13	96	188	11	109	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCM59513.1	2.01e-97	2	288	1	300
QIU94901.1	2.22e-97	1	288	10	304
BBD44537.1	4.04e-97	34	288	47	300
QUR42145.1	8.95e-97	1	288	10	304
QUT70157.1	1.27e-96	6	288	15	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EYB_I	8.47e-06	92	177	24	112	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6YT5_G	8.49e-06	92	177	46	134	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.70e-20	40	289	62	309	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.70e-20	40	289	62	309	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002922_00903.