CAZyme Information: MGYG000002922_01306

Basic Information

• Species: RC9 sp900541925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900541925
• CAZyme ID: MGYG000002922_01306
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000002922_11|CGC2	38632.11	4.6974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002922	2264361	MAG	United States	North America

• Gene Location: Start: 74306; End: 75340 Strand: -

Full Sequence      

MKSFFSAIILLLAVSCRPGGDVVKVVSQDGSGDYTTVQAAFDDVPEGFDGGRWIIRLRPG
KYYEKVILRGGKDNVTLLGEDPLTTVIWYDDYAGSDTSQPKQSTTIEADDFTAANITFLN
PHQNIREKPGENSRSQATALSVTGDRLAFYNCRMIGNQDTFWGRGEGRVYVRKCYIEGNV
DYIYGDSMMVFDECEIFSNQHESYITAASTRPHNRFGITFLDCRLTAKNPGEPDHDGVPF
EYFYLGRPWHNTPKVAFIRCEEPGSIHPDGWTVMNPSAVPDFCEYRCFGPGASPDRLMSR
KMGGRQLGDDEAAAYTVANIFSKDSSPLYEEDWNPDRILSIFER

Enzyme Prediction     

No EC number prediction in MGYG000002922_01306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	25	321	2.7e-83	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	2.51e-59	26	315	9	290	pectinesterase
pfam01095	Pectinesterase	1.69e-55	25	319	3	293	Pectinesterase.
COG4677	PemB	1.52e-49	20	323	80	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02665	PLN02665	2.88e-49	26	315	72	348	pectinesterase family protein
PLN02497	PLN02497	3.32e-45	6	299	14	301	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36869.1	2.73e-152	8	335	11	336
AFN74120.1	6.92e-91	17	343	775	1096
QDH80193.1	5.29e-68	10	339	19	329
AGA79315.1	6.79e-66	26	339	33	329
AWW32646.1	9.58e-66	26	339	33	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.39e-29	25	325	10	306	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.59e-29	25	321	34	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	2.77e-27	22	335	7	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	3.38e-26	25	325	6	302	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.20e-24	26	292	13	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.27e-43	26	315	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9LY18	2.23e-36	23	292	66	323	Probable pectinesterase 49 OS=Arabidopsis thaliana OX=3702 GN=PME49 PE=2 SV=1
Q9ZQA3	1.40e-34	22	324	89	382	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
D8VPP5	3.40e-34	22	312	66	340	Pectinesterase 1 OS=Olea europaea OX=4146 PE=1 SV=1
Q9SIJ9	1.02e-33	26	315	53	320	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000040	0.034961	0.964982	0.000012	0.000014	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002922_01306.