CAZyme Information: MGYG000002925_00840

Basic Information

• Species: CAG-877 sp900548695
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-877; CAG-877 sp900548695
• CAZyme ID: MGYG000002925_00840
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000002925_3|CGC1	45299.31	8.9266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002925	1410926	MAG	United States	North America

• Gene Location: Start: 123493; End: 124656 Strand: -

Full Sequence      

MKCIFTLGSPAIGGGTNVIFEHATRMAKEGEDVYIVTENKVKPEEYAWHSFAHLLKWVTY
DEITDIEFDIAIATWWRTVYETYRIKAKHYAYFVQSIESRFYPENEVGLKMLAEMTYMLD
MKVITEATWIKNYLENYGVDAYLVHNGIRKDIFTLKGDKFKKKDGLRVLIEGPVDVDFKN
VPKTVELVNKSEADEVWLLTSSNIKQYPNVDRVFSRVPPKDCAKIYRSCDVIVKLSYVEG
MFGPPLEMFHCGGTSIVYDVTGHDEYIIHEKNGLVAKTDDDEKVIEYINKLKNDSEYLDK
LKKAAIKTADKWVSWEESSLNFYNVVKKLNKMDSISQKVLEKKSKFFFDIYVKYENKDDT
SIKKFIGKRLRNKHPRIYKIYRKIIRK

Enzyme Prediction     

No EC number prediction in MGYG000002925_00840.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.41e-19	4	325	5	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	2.49e-14	204	307	52	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
COG0438	RfaB	1.52e-11	1	329	3	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	7.32e-07	200	309	235	344	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03800	GT4_sucrose_synthase	5.35e-06	205	317	277	391	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SYX86457.1	4.58e-138	1	383	1	394
AGA59920.1	1.66e-136	1	382	2	396
BCL63251.1	8.25e-120	5	322	7	336
ASL82227.1	1.31e-119	2	322	3	326
QDI32461.1	1.85e-119	2	322	3	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002925_00840.