CAZyme Information: MGYG000002930_00965

Basic Information

• Species: Prevotellamassilia sp900540885
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900540885
• CAZyme ID: MGYG000002930_00965
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	MGYG000002930_20|CGC2	61960.93	7.8584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002930	2680968	MAG	Mongolia	Asia

• Gene Location: Start: 30297; End: 31970 Strand: +

Full Sequence      

MKMVKCFAFAFAALLTLGSSLAQAQSLSPSTKWHWNKGTIEIETPARPAGQKDVIGLKLP
KIKKVRIGLVGLGMRGPGAVENFCVIPGVEVVALCDYVPERAEACQQYLRKAGLAPAAIY
SGENGYKELCARPDIDLVYVATDWEHHFPVAEEALKHGKNVADEVPSAMNLEECWKLVNL
SEKMQKNCMILENCCYDWFEMRTLNMAQHGVFGEIIRAQGAYIHNLDDFWDYYWKNPNGS
DPEQLGWRLKYNRENRGDVYATHGLGPVAQALDIHRGDRMKTLVAMDTKSVHGKELVEKK
TGKPCNDFRNGDHTTTLIRTENAKVIELQHDVMNPQPYNRLYQLTGTKGFANKYPVEGYA
VDSKQLASAGHQPKVDNLSSHSFMPESEKQALEKQYESPILAKFGELAKKVGGHGGMDFI
MCARLIYCLQHGLPLDMDVYDLAEWCCIAELGALSMDNNCASVTFPDFTRGEWNKVKGYK
HAYATAEEEAAVEAYSAKVTEAQKQAAAKYNLWKLYDDVKAAKDATAKAKAQKAYNAAAA
KAKAQVAKAEKALNKKK

Enzyme Prediction     

No EC number prediction in MGYG000002930_00965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	61	475	7.8e-153	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	8.10e-22	63	362	2	268	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.15e-14	65	190	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	2.37e-05	63	172	16	135	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	0.001	133	183	63	113	putative oxidoreductase; Provisional
PRK10206	PRK10206	0.003	133	233	63	155	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13386.1	1.40e-293	1	521	1	520
QCQ31109.1	1.08e-280	6	509	13	509
QUT75090.1	6.18e-274	7	492	11	490
ALJ58162.1	2.80e-273	13	500	30	515
QUT90820.1	3.24e-272	13	500	30	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.68e-84	47	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.47e-69	63	477	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3EC7_A	1.07e-08	65	224	24	178	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3EVN_A	1.20e-06	62	227	3	161	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
4KOA_A	2.87e-06	65	178	2	107	CrystalStructure Analysis of 1,5-anhydro-D-fructose reductase from Sinorhizobium meliloti [Sinorhizobium meliloti 1021]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	6.42e-267	24	501	27	505	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	1.29e-265	31	501	33	504	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	9.53e-257	14	548	11	542	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	3.64e-201	40	484	36	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	5.16e-200	13	484	13	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998918	0.000186	0.000199	0.000174	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002930_00965.