CAZyme Information: MGYG000002933_00008

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_00008
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672	MGYG000002933_1|CGC1	76544.01	4.9535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 20184; End: 22202 Strand: +

Full Sequence      

MSKVFYPLSVCSFLFLWGGVLSSCSDDALSVGKWNIAYDREGKGIDITQNDRLVYDNLYA
SYKLSDSLVSTRDYAKKEISSAPIDDGFGKGVLYKIVYKDTKLPELEQSFYVYPEKDYVL
TEFTIAGEQQEVSSNYMAPINVDKMTTLLPAGVDNRVLFVPFDNDCFIRYQSHTMEFDTL
TSYEVTAVFNNTHRNAYVVGSVEHDNWKSAVTVGKSGEEALGSLTAFGGVADKTTRDSKA
HGSLTGKKIKSPKMLIGFFNDWREGMEEYAQANAVIAPPRAWDKAVPFGWNSWGALQFNL
TYPKALEVSDYFKENLQNNHFVNPDKTLYIGLDSGWNSFTEQELKSFVERCRANGQKAGI
YWTPFTDWAKNPERVVEEMPQYKYKDIYLYANGQPQELDGAYAIDPTHPAVEAMMKKYSD
LFHRTGFEYVKMDFMSHGSMEADKWYNTNIKTGIQGYNYGMTLLDKYFGDMYLNLSISPL
FPAHYAQSRRIACDAWNKIKDTEYTLNALSYGWWLDFVYQYNDSDHIVLRDAEEGENRAR
VTSGVITGIFIAGDDFSKGGKELVKKRAQKYLTNEAVNKVATGVSFRPVEGNGAQSENQF
VRFEEDGSCYYAVFNYGDEILTMNVSLERLGLNKEKEYEIKELWRNTEQVVTDVLSCTIP
ARDVMLFHIQAR

Enzyme Prediction     

No EC number prediction in MGYG000002933_00008.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.92e-16	287	571	3	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	4.94e-07	605	669	12	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	4.73e-06	267	439	272	456	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	3.65e-05	287	525	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII66839.1	0.0	18	670	22	674
ALA72670.1	0.0	18	670	22	674
QJR53686.1	0.0	18	670	22	674
QJR61515.1	0.0	18	670	22	674
AND18605.1	0.0	18	670	22	674

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000028	0.015574	0.984422	0.000005	0.000007	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_00008.