CAZyme Information: MGYG000002933_00257

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_00257
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
968	MGYG000002933_3|CGC1	110622.18	6.9438

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 28347; End: 31253 Strand: -

Full Sequence      

MKKLFVVLFLLCGISVCAQIRVNDREQDSSDFPLCVGGKACDIYIDSSDFEVVKKVSSLF
AEDVERVTGHRNRVDSKRTPEGKAVMVIGTLGHNRFIDELVEQGKLDIATIRNGWEQYLI
QTVDNPAKDVSRALVIAGCDRRGTAYGTFALSEAIGVSPLYWWADVPVKQQKALYVGALR
YVSKAPSVKYRGIFINDEGWGITPWAAKTFDRELGDIGPKTYAKICELLLRMKANMLAPA
MHPGSGAFNKYPENKIVADSYAIVMTSSHCEPLLFNNVSEWHKETMGEWNYMTNKAGINK
QLDKRIAENGKYENFYTLAMRGIHDAGLVGVPKDKEVSVVEEVIKDQREILSKHIPENID
SIPQLFVPYKEVMDIYERGLKVPEYVTLVWPDDNWGYMKRLSNKEEQKRKGEAGVYYHIS
YCGEPHDYLWLNTTPPTLIYEEMRKAYDTGAKRYWLLNVGDIKPGELGMKFFMDMAWDVN
RFNMDTAYEFNTDYLTSIFGEQYRNDLKDIIDTYYLLGFQHKPEAMGWGYVWNNYRDRER
VVDTDFSFVNYNEAESRMKEYDRIAAKAQKMLHALPEAYQAAFYELVYYPVKGADLMNKK
MLTAQKSRWYARQRRAATNECAEQAKIYHDSLTYYTDRYNSLLDGKWNHMMAVSPGWMGE
YQKMPPVDTCAAAQDADMQVFIPGQDCTVGVSSVNVLPTVNPYINKDLFIELYNRGSQSF
VWKATPKASWIKLNKHSGQTALQERIGVSVDWQNVPKGERMTGEIEITSGDKIEKVYLPV
FNPQSPTREELKGLYVEDNGCISINAGAFHRKKESNEIKIRTVKGLGYENTCVQLGEATQ
AVQEMWFTDRTPRAEYDFYTFNGGRATVYVYALPVFPIDSKHDTRFGIMVDDGMVQWLTT
SAKEYSSQWRLNVFRNSAVSVMTVNIGRPGKHTFKLLCADPGMIIQKIVIDFGGMKRSYL
GPNVTRVE

Enzyme Prediction     

No EC number prediction in MGYG000002933_00257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	30	667	2.2e-229	0.8393113342898135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.62e-165	184	524	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.66e-46	795	962	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam05124	S_layer_C	8.93e-06	36	155	106	221	S-layer like family, C-terminal region.
pfam13004	BACON	0.002	721	780	2	58	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07546.1	0.0	1	968	2	966
ALK86808.1	0.0	1	968	3	967
AYD49386.1	0.0	18	965	23	963
QUR45612.1	0.0	1	966	1	982
APZ45930.1	0.0	2	968	6	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.19e-155	20	962	14	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	1.64e-126	38	655	25	619	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
6NPS_A	1.29e-111	53	965	32	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4C90_A	3.10e-111	1	966	12	850	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	1.21e-100	22	669	6	642	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002786	0.666339	0.330087	0.000268	0.000239	0.000256

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_00257.