CAZyme Information: MGYG000002933_00297

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_00297
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002933_3|CGC2	41151.73	4.0632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 86719; End: 87816 Strand: +

Full Sequence      

MKKIKNWWMGLLLLAGVAITSCNDDDKPVFPETPEETYDMTGFARGADVSWLTEMEAEGR
TFYDADGKERECMSLLRELGMNAIRLRVWVNPADGWCNQNDVIAKAWRAHNLGYRLMIDF
HYSDTWADPGSQTKPAAWENYTFDELRQAVATHTTEVLTALKNQGIDVEWVQIGNETSNG
MLWDEGMASTNMANFAALVNAGYDAAKAVYPDAQVIIHLDRGNELTHYTWIFNGLQENGA
KWDIIGMSLYPGEDPDDSNGLTEWNPVDENGQTWQEQNDACIANMQSLIDTYQTQVMVCE
IGVPWNYEQAEAFYTDFVTKAKQVDGCLGVFAWEPECYGGWNGYQKGMFDDTGKPTASFN
AFARD

Enzyme Prediction     

No EC number prediction in MGYG000002933_00297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	45	361	2.1e-96	0.9912280701754386

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	6.80e-99	44	362	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	2.94e-82	1	362	2	391	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95127.1	1.54e-169	1	364	1	364
QNL36930.1	3.74e-167	13	364	12	361
QGT73995.1	1.52e-166	13	364	12	361
QRQ56247.1	1.52e-166	13	364	12	361
ALJ49465.1	2.09e-166	13	364	21	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GP5_A	1.23e-105	25	362	22	349	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GPA_A	1.15e-104	42	362	6	313	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
7OSK_A	1.92e-44	11	326	17	318	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	2.35e-40	45	364	5	331	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1R8L_A	4.91e-40	43	335	24	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	5.40e-56	43	361	6	345	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	4.12e-40	45	335	26	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
P83692	1.29e-39	45	364	5	331	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
Q65CX5	4.28e-39	43	335	49	347	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
Q4WJ80	1.16e-38	45	335	26	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000033	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_00297.