CAZyme Information: MGYG000002933_00419

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_00419
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000002933_4|CGC3	72317.35	4.9947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 109450; End: 111366 Strand: +

Full Sequence      

MKQLIRGFVIAGMVAGCLACSRSAQEMPPNSTRYEFGDILNIALTPDSTVRRAGCFTDAG
SWMGFTIPETDKWVNGFCGPFSLDNRIWFAQSAVCVDFLDGNGTLTPDSAIYFPGEVYIA
SSSNDRKIEQRMNFVNSSTALLQVSSNVAEGFKFTGKDWNSKVRLERGEQTITAYHPNGE
VVQLTFMPDVELSCDGKNYVASTAADCQQMNVAVSFYFSDKELASGAQKSVALLQNPQPE
LAANAKRWEEYLQKVLRKDMKHEYDRVAVKSVVTLISNWRTHRGGLLHEGVIPSHAVTYF
MGFWAWDSWRFSAALARFAPELAKNNIRAMFDYQWPDGMIIDCIYTNPAENNARDSKPPL
VCWAVDEIFTHNQDTAFVKEMYPQLLAYYKWWYNKRDHDRNGMCEFGSTDGTLEAAGWES
GMDNAIRFDNAKMLKNGNDAWSLDQESVDLNAYLAYECKLLKKFAALIDTTFDAPDYSDK
VADYFFDEKIGYFCDRRLKDGSFIEEPACEGYTPFWTQIATKKQMEKALVLFTDTTKFST
YIPFPTAAADNPKCDPNGYWRGPIWLDQTYQAIKGLRNYGYNDLADKYTLQVFDRCQGLT
GDAPIHENYGTHTGERLQASHFSWSASHLLMLYEDYGK

Enzyme Prediction     

No EC number prediction in MGYG000002933_00419.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	180	636	5.2e-115	0.5929824561403508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.81e-131	56	636	59	783	alpha-glucosidase; Provisional
COG3408	GDB1	9.36e-16	290	633	271	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	8.56e-09	375	634	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	3.01e-08	356	587	178	450	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	1.82e-04	416	587	324	494	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	5	638	6	638
QUT86878.1	0.0	9	638	10	644
QJR61716.1	0.0	9	638	10	644
AII67042.1	0.0	9	638	10	644
AII61903.1	0.0	9	638	10	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.11e-74	51	636	27	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.62e-73	51	636	27	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.63e-73	51	636	27	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.81e-70	51	636	28	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.58e-37	51	409	353	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	4.13e-73	51	636	50	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	3.20e-19	304	627	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	4.26e-19	304	627	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	8.99e-07	290	630	26	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
P53008	8.73e-06	375	579	538	762	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000945	0.061854	0.936623	0.000160	0.000255	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_00419.