CAZyme Information: MGYG000002933_01939

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_01939
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		70043.72	8.8511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 116; End: 1969 Strand: +

Full Sequence      

MKAIPNFFVLLPINKSRNKKTMKFIHTLCLSLVLTFGSMGTPVQAQNGNEYFLHTITKGQ
SLYSISSMYNVTIEDIVRLNPGCEKQIRAGETLKIPQVNSGSNQEKPTFHTIQAGETLYQ
LTVKYNVTAQAICDANPGLSASNFRIGQVISIPAQSAIKQPQENLANAGKDSEANAHSNE
WRDMHKVARKETIFSISRKYGITQEELIAANPELKNGKLKRGMFLFIPYPASQPVKDTQE
KTPVNAPSNEELFKQSEPSPRKIQTVKAAVILPFTEGQSHDEQLRMIEYYEGFLIAVDSL
KKQGVSLDIYTYDTKGNTASTGTILSKPELKDMDIIFGAVHANSINQLTDFAEKNKVRVV
IPFSPEVKQVFRNPYVYQVNTPQSYLYSEVYEHFLRKFSKANVVFLDAGTGSKDKDEFIK
GMKTELSNNQISYQSITNVDTLKLLAAIDANKTNIFIPTSGQDLALNRLVPQLTQIRRSH
PEADIHLFGYPEWQTYTQDYLASFYELDTYFYSSFYTNNLFPAAVDFTQSYRRWYSKDMA
NIFPKYGMLGFDTGYFFLKGLSQHGNKLEENLNAIQVIPIQTGFKFERVNNWGGFINRKV
FFVHLTKDFELIKLDFD

Enzyme Prediction     

No EC number prediction in MGYG000002933_01939.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	7.06e-10	35	211	392	576	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	2.13e-09	108	152	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	4.46e-09	37	267	316	553	1,4-beta-N-acetylmuramoylhydrolase.
cd00118	LysM	1.12e-08	185	227	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	3.46e-08	110	153	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25583.1	1.74e-301	22	617	1	601
ALA74972.1	1.78e-258	22	617	1	602
QJR68229.1	1.02e-257	22	617	1	602
QJR60047.1	1.02e-257	22	617	1	602
AII69224.1	1.02e-257	22	617	1	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2YVT4	1.47e-09	41	248	16	212	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1
Q6GC24	3.46e-09	41	211	16	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q5HIL2	3.46e-09	41	211	16	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1
P0C1U7	3.46e-09	41	211	16	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1
Q7A1T4	3.46e-09	41	211	16	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.028223	0.957707	0.013112	0.000425	0.000267	0.000257

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_01939.