CAZyme Information: MGYG000002934_02510

Basic Information

• Species: Caproiciproducens sp900546895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Caproiciproducens; Caproiciproducens sp900546895
• CAZyme ID: MGYG000002934_02510
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		33995.41	4.4713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002934	2823222	MAG	Russia	Europe

• Gene Location: Start: 2783; End: 3691 Strand: -

Full Sequence      

MEDVLGIPQSDLPVLEYDDCINLLKGAIESANRVTTVSPTYAQEILDPWFSHGLDSILQA
REWKLSGILNGIDTVSYNPASDPELYAPYSAEDLSGKAENKSKLQERLNLNKEPNTPLIG
MVTRMVSHKGLDLVKEVLDRLMRETNTQFVILGSGDWEYENFFREMQERYPGRLCACFGF
IPELSRKVYAGSDIFLMPSKSEPCGLAQMIALRYGSVPVVRETGGLKDSIKDSGDGEGNG
FTFRTYDSGDMLYAINRALEGYSDPEGWSILVERAMKCDFSWGRSANEYIRLYRDLMKEN
QS

Enzyme Prediction     

No EC number prediction in MGYG000002934_02510.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	4	294	6e-116	0.6207627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	4.68e-158	5	295	181	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.01e-153	5	298	170	465	glycogen synthase GlgA.
TIGR02095	glgA	8.05e-136	15	296	190	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.18e-125	15	294	193	476	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.79e-89	5	302	182	485	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34691.1	1.81e-185	1	300	176	475
QNO18264.1	1.16e-178	1	299	176	474
ARP51332.1	1.81e-175	1	299	176	474
QKN23272.1	1.81e-175	1	299	176	474
QKO30046.1	1.81e-175	1	299	176	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	1.35e-70	19	293	211	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	1.30e-66	15	293	189	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.10e-66	15	300	189	480	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.40e-65	15	300	189	480	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	2.76e-61	15	293	339	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	4.63e-92	1	301	176	479	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	1.84e-91	1	301	176	479	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
P39125	1.13e-89	3	301	178	480	Glycogen synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgA PE=2 SV=1
Q3A0B8	2.26e-89	15	294	196	476	Glycogen synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=glgA PE=3 SV=1
A0PY73	2.78e-89	16	297	194	476	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002934_02510.