CAZyme Information: MGYG000002935_00148

Basic Information

• Species: Phocaeicola sp002161765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161765
• CAZyme ID: MGYG000002935_00148
• CAZy Family: GH30
• CAZyme Description: Glucuronoxylanase XynC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000002935_2|CGC2	35965	4.2236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002935	2727252	MAG	Finland	Europe

• Gene Location: Start: 40503; End: 41456 Strand: +

Full Sequence      

MGDKVDDTDHLKPECYTEYADHLIRYVEFMKENGVNIYAISVQNEPDMDFTAWTPQEVVT
FLKQEGARIRETGVKLMSPEACGYQPEYTDAVLNDVDAFAQTDIVAGHLYQGFIDLSSSY
VKDRHDYVCGLYPRLGGKTWWMTEHLFNDGENEEDPSLWQFWNWDYNFSHLAKEIHMCMD
GYCSAYVYWYLKRFYGMIGDTDERCKEEEGEVSKNGYILAHYAQYATNTTRIAVTSGSEN
IDATAYINESGDEITLVLLNQSDRALTIAIPVSGISQATAVETNEEKNMEAVSVEVTGEY
ASLSLSGKSIVSVRLKL

Enzyme Prediction     

No EC number prediction in MGYG000002935_00148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	8	274	4.1e-79	0.7046783625730995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	3.16e-46	11	244	143	346	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	6.56e-06	230	313	3	63	Glycosyl hydrolase family 30 beta sandwich domain.
pfam02055	Glyco_hydro_30	1.58e-04	19	111	131	237	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90760.1	6.25e-158	10	317	237	546
ALJ58222.1	6.25e-158	10	317	237	546
QUT78601.1	4.53e-153	10	315	238	545
SCV07741.1	1.01e-152	10	315	209	516
EDO10799.1	2.59e-152	10	315	238	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UQA_A	1.89e-37	11	310	125	405	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4CKQ_A	9.86e-37	11	310	125	405	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4QAW_A	1.04e-36	11	304	104	362	Structureof modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_B Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_C Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_D Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_E Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_F Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_G Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_H Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
5A6L_A	7.15e-36	11	310	125	405	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]
1NOF_A	8.83e-36	11	311	101	370	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	2.50e-34	11	310	137	415	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	6.78e-34	11	316	138	422	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002935_00148.