CAZyme Information: MGYG000002935_01691

Basic Information

• Species: Phocaeicola sp002161765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161765
• CAZyme ID: MGYG000002935_01691
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770		89305.28	5.8239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002935	2727252	MAG	Finland	Europe

• Gene Location: Start: 3201; End: 5513 Strand: -

Full Sequence      

MKQVWKGAMLFLLTLLPFASAHAKPTEAEQVRKIIDKVNQHWQATNSPEVRSFWDNAAYH
TGNMEAYFLTGNEAYRAYSEAWAKHNEWKGAKSNNRAEWKYSYGESDEYVLFGDYQICFQ
TYADLYMLDPDDYKIRRAREVMEYEMSTPNHDYWWWSDGLYMVMPVMTKLYKITHNPLYL
EKLYEYLLYSDSIMFDKDENLYYRDAKYVYPKHKSLNGKKDFWARGDGWVLAGLAKVLKD
LPEDYEHRAFFVEKFQKMAKAVAAIQQPEGYWTRSMMDPEHAPGPETSGTAFFTYGMLWG
VNHGYLNEATYMPVIQKAWKYLSEKALQKDGSVGYVQPIGEKAIPGQVVDAKSTANFGVG
AFLLAACEYVRYLEASTQPDRAYWCRLAYQMAEPVLSNMAKGELQKNMQVEVSPTWDGRD
KRVTYMECFGRLMAGIAPWLTLPDDDTEEGAMRKQLREWALKAYTNAVDPNSPDYLLWRN
EGQPLVDAAYVAESFLRAFDQLWMPLDETTKKRYIEEFTQLRRIDPPYTNWLLFSATIES
FLAKAGAPFDIYRINSAIRKVEEWYTGDGWYADGPSFAFDYYSSYVFHPMYLETLDALID
ADKHSRLDYPKYYQRALKRAQKFSLILERFISPEGTFPVFGRSIPYRMATMQPLALMAWY
KELPAGVTPAQVRCGLTAVLKRMFASGNNFNEGGFLTIGFTGRQPNIADWYTNNGSLYMT
SLAFLPLGLPASDAFWTDAPQDWTSKKAWSEQPFPKDHHWSDDIQTRDLY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	380	741	7.4e-108	0.9942528735632183
GH105	46	371	6.8e-80	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	1.82e-159	380	743	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	4.03e-95	31	373	6	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	5.50e-70	426	747	69	371	Uncharacterized protein [Function unknown].
COG4225	YesR	4.79e-37	62	371	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36172.1	0.0	1	770	1	770
QQY40390.1	0.0	1	770	1	771
ABR38224.1	0.0	1	770	2	772
QUT56470.1	0.0	1	770	1	771
QEW35177.1	0.0	1	770	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.34e-199	24	378	26	380	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.12e-167	19	374	3	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.02e-55	54	371	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.14e-12	151	368	136	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.47e-12	151	368	126	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.33e-54	54	371	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	2.40e-53	54	374	58	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.62e-40	154	368	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	6.24e-12	151	368	136	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000445	0.998784	0.000215	0.000198	0.000180	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002935_01691.