CAZyme Information: MGYG000002938_01305

Basic Information

• Species: Clostridium_B sp902809985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_B; Clostridium_B sp902809985
• CAZyme ID: MGYG000002938_01305
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		27295.72	9.8839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002938	2518779	MAG	Russia	Europe

• Gene Location: Start: 30; End: 752 Strand: +

Full Sequence      

MYKRQVYDIPENKIIVIPHGVPDITVENKDVLKRSLGYDGRNIISTFGLLSSGKGIEYGI
EAINQVVKTHPEVLYLILGQTHPCVKKVEGEAYRNKLQNLVSKFHIENNVKFVNKYLTKR
EIVQYLTLSDIYMTPYLASEQAVSGTLAYAAGYGKVIVSTPYRYAEEMLNDNRGILAKFK
NSTSLAQAITYLLDNPTVMRNMEKNMSNLGKKMKWPYVAKQYENLFLNTIKASKITKQVV

Enzyme Prediction     

No EC number prediction in MGYG000002938_01305.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	8.78e-66	4	226	150	369	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
cd03801	GT4_PimA-like	2.64e-25	4	226	156	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.94e-20	7	233	167	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03799	GT4_AmsK-like	4.40e-17	10	228	146	347	Erwinia amylovora AmsK and similar proteins. This is a family of GT4 glycosyltransferases found specifically in certain bacteria. AmsK in Erwinia amylovora, has been reported to be involved in the biosynthesis of amylovoran, a exopolysaccharide acting as a virulence factor.
pfam00534	Glycos_transf_1	8.23e-14	40	205	1	154	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXE17952.1	3.48e-121	7	240	153	386
AGY74965.1	1.41e-120	7	240	153	386
ADK15713.1	1.41e-120	7	240	153	386
ALU35138.1	1.41e-120	7	240	153	386
AZV57594.1	1.14e-119	7	240	153	386

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58469	7.94e-06	48	226	219	387	Uncharacterized glycosyltransferase MJ1069 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1069 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002938_01305.