CAZyme Information: MGYG000002939_01119

Basic Information

• Species: Enterococcus_A sp002140655
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A sp002140655
• CAZyme ID: MGYG000002939_01119
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000002939_150|CGC1	54753.83	5.4582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002939	2985142	MAG	Russia	Europe

• Gene Location: Start: 1571; End: 3004 Strand: +

Full Sequence      

MQKEKQFLWGGAVSAAQSEGNYLADGRKPSNFDYLPLDDRRLKAVYKNQAASILDSTGDE
IYPGRNGNDFYHHYQTDIALLKELGVNSFRFSISWSRIFPTGEEQEPNEAGLQFYEKLLT
ELEKHQMEPIVTLSHFEIPIHLVEKYNGWESRKVVDLFLHYAETVMKRFKGRINYWIPFN
EMNMVLHIPFIGGGILFEEGKDNLSIQYQAGHHQLLANALTIKAGKQIDPENQFGAMLAA
GKTYAYTCDPKDVFAALQQEKENLLFSDVQVFGDYPKFFAHYMVEKGLKLTIYPEDRKIL
KDNTVDFVSFSYYSSACTAAEENGIDRVATNGYTTLRNPHLPKGKSVWQDDPLGLRITLN
QLQDRYHKPLFIVENGIGTQDEFVDGKVHDDYRIHYLQEHVKNMMLAMEEDGIELMGYLM
WGIIDLPSVSEGRISKRYGVVYVDQDDENNGSHQRFKKDSFAFYQKVISSNGAVVFE

Enzyme Prediction     

No EC number prediction in MGYG000002939_01119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	472	3.7e-136	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	7	473	8	471	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	472	6	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	5	473	8	475	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	1.48e-170	5	472	6	473	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	7.55e-145	5	472	8	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ11770.1	0.0	1	477	1	477
ALS01765.1	1.02e-257	1	476	1	476
AWZ44910.1	1.48e-254	1	477	1	477
QNN72044.1	2.94e-251	1	477	1	477
ALB28271.1	1.26e-208	7	468	5	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.10e-159	7	472	12	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.16e-143	5	472	9	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.29e-143	5	472	9	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	1.17e-142	7	477	24	487	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3PN8_A	1.96e-139	5	472	9	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	9.28e-167	5	472	6	470	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	5.49e-162	7	472	12	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	8.16e-145	7	472	8	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	1.63e-139	7	472	9	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P42973	2.59e-139	5	472	6	476	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999886	0.000170	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002939_01119.