CAZyme Information: MGYG000002939_01584

Basic Information

• Species: Enterococcus_A sp002140655
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A sp002140655
• CAZyme ID: MGYG000002939_01584
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000002939_253|CGC1	55501.13	4.6579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002939	2985142	MAG	Russia	Europe

• Gene Location: Start: 2044; End: 3498 Strand: -

Full Sequence      

MEWTQEMRYRPYQEWSEKYVRELKTNVEQSKWRLNYHIQPETGLLNDPNGFSFFNGKWHL
FYQSFPFGAVHGLKTWYHLSSTDLIHWESEGAALEPDRAFDSHGAYSGSALPVGEALFLA
YTGNVRDQSWERRSYQLGAWMNKKGEIKKVAEPLISEPPAGFTAHFRDPQLIRSNDEYLM
VIGGQTLDEQGEVLVFASQDLVDWQYRGPMNIHQDLGFMVECPNLLSIEEHVVLLLCPQG
LKELDYQNVYPNTYILAEEYSAETNSLKNPQKQQVLDEGFDLYATQAFTAPDGRCLSVGW
IGLPEMSYPTFGEGWAHSLSLIKELTIKDGKLYQYPVEETQRLRGSQESLVAEANETFMK
QTANSYELQLEIPSNCQGSVHLFSDSINEKSLVLSYDTKQGKVRLDRSKTDYPLNPEFGE
TRETIVEQGKSLTIAIFVDKSTCEIFINAGERTLTANYYPTEEQTYLLLENSQKCHASYY
TLNK

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	336	3.8e-82	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	20	460	1	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.02e-157	5	470	1	469	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	1.07e-146	43	329	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	7.90e-123	37	450	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.48e-121	37	336	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG40102.1	3.85e-261	1	484	1	486
BAK93626.1	7.92e-192	3	469	7	479
AYW51385.1	1.01e-191	2	469	3	476
QGP77497.1	8.23e-191	2	469	3	476
QXN87096.1	1.84e-190	2	469	6	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	5.09e-133	1	483	1	486	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	5.61e-62	36	469	29	468	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.69e-57	17	459	34	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.43e-56	17	459	34	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	5.52e-54	35	448	5	395	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43471	2.52e-157	1	459	1	461	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13522	9.54e-152	1	482	1	477	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
Q04937	7.13e-126	1	474	1	465	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
Q05936	6.54e-112	2	465	3	469	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.69e-103	3	459	7	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002939_01584.