CAZyme Information: MGYG000002941_00938

Basic Information

• Species: Actinomyces graevenitzii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces graevenitzii
• CAZyme ID: MGYG000002941_00938
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000002941_22|CGC1	61136.99	4.6357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002941	1921862	MAG	United States	North America

• Gene Location: Start: 2784; End: 4430 Strand: -

Full Sequence      

MTTSAEDLLQSALAAQQRSTANADPDYPLVHLTAPVGRLNDPNGLLVDEDTYHAFFQYTP
EHPRRLVYWGHATSNDLLHWTHHAPAIVPDSPYDRNGAYSGGAIILDADELSWVDPAVAH
TYVLHYTGNLKDAVTGERDATQDAVVSDDLINFTKLADNPVVRRQPEGYTAHWRDPQVWR
DAEGYRMLLGTQRKNETGAALLYRSEDLRHWQLEGELEIPGFSDTIATGYMWECPNLMRL
RDEVDGQYYDVLIICPQGMKPGVEGFENVFPCIYLVGHLRGTRLEDTGGRFAEVDRGFEF
YAPQVFAHRREQTPDGKALLMAWAGNAGEDEQPSIHSGNWVHTMSMVRELSLRGGKLIQR
PLPVLEDVPNQRSTQAESAAWEESATTYDSALEGEAADQALASALNLDQTCAALANSRSW
RLRATVNLSQEVLIRIGDENSHVDIILGRNYLEVDRSTSAYPHGGRRRISLSEQVKRSIE
LIHDRSITELFVDEGELAFTLRSFLPATACGFSVFVKETDAFGNTVLTDVSNQGENAVIS
SITYMKND

Enzyme Prediction     

No EC number prediction in MGYG000002941_00938.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	361	4.2e-90	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	4.60e-128	37	354	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	4.03e-124	14	515	16	469	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
TIGR01322	scrB_fam	3.17e-120	16	505	3	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
smart00640	Glyco_32	3.73e-107	31	495	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	5.58e-102	31	361	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ60382.1	3.38e-178	1	518	1	495
AMD99895.1	1.10e-176	6	516	3	493
VEG53876.1	1.67e-175	5	511	2	488
QQC40669.1	2.90e-174	1	516	1	493
QCT33181.1	1.17e-173	6	517	3	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BWB_A	2.46e-48	21	504	42	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.30e-47	21	504	42	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	6.42e-47	18	504	24	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	3.14e-45	27	504	26	458	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
1UYP_A	1.50e-39	28	502	4	403	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	7.69e-75	21	366	23	343	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	4.02e-69	8	504	10	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	1.16e-67	8	362	10	337	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P43471	3.19e-63	31	514	37	471	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
P13394	1.74e-59	7	505	23	454	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002941_00938.