CAZyme Information: MGYG000002942_00476

Basic Information

• Species: TM7x sp900555885
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; TM7x; TM7x sp900555885
• CAZyme ID: MGYG000002942_00476
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor RpfB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22347.03	9.1168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002942	559257	MAG	United States	North America

• Gene Location: Start: 2200; End: 2796 Strand: -

Full Sequence      

MKEKNIDPKKDDTLSVDRSAKIIPGMKIELWRNGKQTITAEEDVKFEVEKVQDANRDSGY
REVKQAGENGKKNVTYEIEMKNGVEVSRKEIASVVTKEPKKQIEIVGTKSSTSFSGSFSE
ALARLRSCEGSYTSNTGNGYYGAYQFDKRTWGNYGGYELASDAPAAVQDEKAWQTYKARG
WQPWPTCKVKMGLQDIYR

Enzyme Prediction     

No EC number prediction in MGYG000002942_00476.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	2.38e-24	120	187	4	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
COG3583	YabE	1.70e-23	1	138	176	303	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	1.20e-20	35	109	1	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam06737	Transglycosylas	4.21e-15	124	187	7	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA06885.1	4.47e-103	1	198	191	388
QCT41697.1	4.47e-103	1	198	191	388
QCT42420.1	1.89e-97	1	198	204	401
AKM80307.1	3.38e-94	1	198	187	384
AHB41938.1	2.50e-39	1	196	184	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E27_A	7.94e-20	19	194	67	248	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
3EO5_A	7.79e-17	32	194	3	171	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	6.73e-11	106	194	14	108	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4EMN_A	1.88e-10	116	194	1	81	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4KL7_A	3.57e-10	125	194	6	80	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
H8EZH5	1.77e-18	19	194	181	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
P9WG28	1.77e-18	19	194	181	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	1.77e-18	19	194	181	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
A0R3E0	1.53e-16	19	194	181	362	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
Q6M6W5	1.89e-11	124	195	43	119	Resuscitation-promoting factor Rpf1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002942_00476.