CAZyme Information: MGYG000002943_00579

Basic Information

• Species: Actinomyces oris
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces oris
• CAZyme ID: MGYG000002943_00579
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000002943_20|CGC2	34599.59	4.8972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002943	3026158	MAG	United States	North America

• Gene Location: Start: 11750; End: 12772 Strand: +

Full Sequence      

MGRHSQTSSLSTTLAGLGSLASKKRADSASHGRRRAEGPAKTSLTPMLFKAGGAAAAFSL
AVSGAAYAAISAGDDEGSSSSGGSFGLIGGESDGQAKAAATPKAGSGKIASAQTSTTTVD
EPQVHSTVKKETDSLPKGETKVETAGVDGLVRTTYEVTTQDGKEVSRTPVAQVVVTKKVD
EVVLVGTGEQQDQQAQQAQQEAAQQAQSAGDGQAAQANGGSEGSNSSTPAPAANPGAGTD
PDSAKAIARSMMAGHGWGDSEFSCLESLWTRESSWNYQAENASSGAYGIPQALPGTKMSE
VADDWATNPTTQITWGLNYISGRYGTPCSAWAHSESVGWY

Enzyme Prediction     

No EC number prediction in MGYG000002943_00579.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07501	G5	1.55e-25	114	187	1	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	2.38e-14	116	187	212	283	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ59027.1	3.12e-201	1	340	1	340
QLF54303.1	2.29e-200	1	340	1	337
QQC39726.1	6.98e-198	1	340	1	340
AMD99065.1	1.08e-195	1	340	1	334
QCT34053.1	1.05e-187	1	340	1	348

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999530	0.000473	0.000001	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002943_00579.