CAZyme Information: MGYG000002945_01945

Basic Information

• Species: Bariatricus massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bariatricus; Bariatricus massiliensis
• CAZyme ID: MGYG000002945_01945
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000002945_9|CGC1	85903.13	4.7263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002945	3969748	MAG	United States	North America

• Gene Location: Start: 119236; End: 121506 Strand: +

Full Sequence      

MKNKLTDREIVEYDKKNLYLGNLNTVEFDLKLPLTGEYGSSITWESNHEGLLKPDGTVRR
PAFGMGNRTVELTATFAHGEVSEKKVYEVTILQEKKELRIRKIYTVHKQVKVKEDFYLPE
SIPVETEDGDTIMRSVSWEGGRRQCLSDVGETSIKGTVEGALQQAEALVDAVEVLETAHR
DKTPRLQSLAAPNQKSRVFLESGSVFYDAQERMHQVLLTTDDDQMLYNFREAAGLDTKDA
PQMIGWDAPDSQLRGHTTGHYLSALALCYHATADDKILEKARYMVGELKKCQDAFAASGN
TKYGFLSGYSEEQFDLLEVYTVYPTIWAPYYTLHKILAGLLDCWRFAGLKEALEIADKIG
DWTYNRLARLTKEQRDKMWSMYIAGEIGGINESLAALYEETGKADHLAAARMFDNEKLFL
PMEMQVDALSGLHANQHIPQIIGAMKIFEVTGEKNYYDIARYFWDAVTKGHIYAIGGTGE
AEMFHPVKEIGRRLTKSSAESCASYNMLKLTQQLYQYEPDVKMMDYYERTVLNHTVASTD
KAVTGANTYFMPLAPGSSKEFDDENSCCHGTGLESQSKYIDSIYYREDDVLYVNLFIPSK
LEWEEKGICAELQTEMKNPGKVSLAVWPMEAKAMGDTVIRVRRPSWNADEYHVFVNGKPS
LTYAEEDGYIQITLEAGGEKQQIDIEFSCNFHIEATPDCPDIVSVFYGPYILAALSEEEE
MMELPDEEKLSGMEWVPFCCVDKESYHLYFKKNERR

Enzyme Prediction     

No EC number prediction in MGYG000002945_01945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	203	713	6.1e-179	0.9880715705765407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.13e-129	204	713	7	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.94e-79	204	714	17	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07532	Big_4	1.80e-05	103	160	1	58	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
cd04791	LanC_SerThrkinase	2.60e-04	336	411	91	169	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY98728.1	3.98e-267	2	751	4	753
ASR48105.1	1.16e-262	1	751	1	757
QNM13425.1	1.46e-257	7	751	5	754
QOS77131.1	2.11e-255	7	753	7	765
ASA23792.1	2.57e-251	1	751	1	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.61e-75	204	732	38	579	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.07e-71	204	732	38	579	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5HO9_A	8.91e-08	6	92	551	637	Structureof truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus],5HO9_B Structure of truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus]
5HO0_A	1.01e-07	6	92	551	637	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002945_01945.